anti-Human CAMK2B antibody for Immunohistochemistry

Recommended CAMK2B Antibody (supplied by: Log in to see )

Antigen
Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) Antibodies
  • CAM2
  • CAMK2
  • CAMKB
  • Camk2d
  • Ck2b
  • camk2
  • camk2b
  • cam2
  • camkb
  • CAMK2B
  • calcium/calmodulin dependent protein kinase II beta
  • calcium/calmodulin-dependent protein kinase II, beta
  • calcium/calmodulin-dependent protein kinase II beta
  • calcium/calmodulin dependent protein kinase (CaM kinase) II alpha S homeolog
  • calcium/calmodulin dependent protein kinase (CaM kinase) II beta L homeolog
  • calcium/calmodulin-dependent protein kinase (CaM kinase) II beta
  • CAMK2B
  • Camk2b
  • camk2a.S
  • camk2b.L
Reactivity
Human, Mouse (Murine), Rat (Rattus)
121
82
81
7
7
6
5
5
5
4
4
4
3
1
1
1
1
1
Host
Rabbit
95
49
Clonality
Polyclonal
Conjugate
This CAMK2B antibody is un-conjugated
3
3
3
3
3
3
3
3
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), In vivo Studies (in vivo), Simple Western (SimWes), Western Blotting (WB)
125
72
43
29
27
18
9
6
6
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4287584
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.404079 ABIN6256533 ELISA ICC IF IHC WB Rabbit IgG pThr286 Log in to see Polyclonal 0
8.404079 ABIN1531792 IF IHC ELISA WB Rabbit IgG AA 256-305, pThr286 Log in to see Polyclonal 1
8.404079 ABIN574217 ELISA IHC IHC (p) WB Mouse IgG1, kappa AA 1-504 Log in to see S11 0
8.404079 ABIN768905 ELISA Func IHC IHC (p) IP WB Mouse IgG2b, kappa Log in to see 0
8.404079 ABIN4287586 IHC WB Mouse IgG1 Log in to see 8D9 0
8.404079 ABIN337356 IHC IHC (p) WB Rabbit pThr286 Log in to see Polyclonal 0
8.404079 ABIN2470694 IHC WB Rabbit pThr286 Log in to see Polyclonal 0
8.404079 ABIN462429 IHC IHC (p) WB Rabbit Log in to see Polyclonal 0
8.404079 ABIN2470939 IHC ELISA WB Mouse IgG1 kappa AA 1-504 Log in to see S11 0
8.404079 ABIN2427875 IHC ELISA Rabbit IgG Log in to see Polyclonal 0
8.404079 ABIN2421307 IHC ELISA Rabbit IgG Log in to see Polyclonal 0
1 ABIN4287585 IHC IHC (p) WB Rabbit IgG Center Log in to see Polyclonal 0
1 ABIN3180521 ELISA IHC WB Rabbit IgG Internal Region Log in to see Polyclonal 0
1 ABIN1871413 IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1867012 ICC IHC WB Rabbit IgG AA 1-301 Log in to see Polyclonal 0
1 ABIN1843015 IF/ICC IHC WB Rabbit pThr286 Log in to see Polyclonal 0
1 ABIN6248713 IHC WB Mouse IgG1 AA 311-385 Log in to see OTI8D9 0
1 ABIN2878193 IHC WB Rabbit Ile423 Log in to see Polyclonal 0
1 ABIN2617864 IHC IHC (p) WB Rabbit C-Term Log in to see Polyclonal 0
1 ABIN2882154 IHC WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(121), (82), (81), (7), (7), (6), (5), (5), (5), (4), (4), (4), (3), (1), (1), (1), (1), (1)
Host Rabbit
(95), (49)
Clonality
Polyclonal
Conjugate This CAMK2B antibody is un-conjugated
(3), (3), (3), (3), (3), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), In vivo Studies (in vivo), Simple Western (SimWes), Western Blotting (WB)
(125), (72), (43), (29), (27), (18), (9), (6), (6), (1), (1)
Supplier Log in to see

Product Details anti-CAMK2B Antibody

Target Details CAMK2B Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPPAALEPQTTVIH
Isotype IgG
Plasmids, Primers & others

Target Details CAMK2B

Product Details anti-CAMK2B Antibody Application Details Handling Images back to top
Antigen
Alternative Name CaMKII beta (CAMK2B Antibody Abstract)
Background Gene Symbol: CAMK2B
Gene ID 816
Pathways WNT Signaling, Interferon-gamma Pathway, Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, Smooth Muscle Cell Migration, Regulation of long-term Neuronal Synaptic Plasticity

Application Details

Product Details anti-CAMK2B Antibody Target Details CAMK2B Handling Images back to top
Application Notes Western Blot 1:500 - 1:1000, Simple Western 1:5, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200 - 1:500, In vivo assayFor HIER pH 6 retrieval is recommended. WB dilution: 1:100-1:500 (Rodent material) and 1:500-1:1000 (Human material). In Simple Western only 10-15 μL of the recommended dilution is used per data point.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-CAMK2B Antibody Target Details CAMK2B Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-CAMK2B Antibody Target Details CAMK2B Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
Immunohistochemistry (IHC) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry: CaMKII beta Antibody [NBP1-88212] - Staining of human lateral v...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human ...
Simple Western (SimWes) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Simple Western: CaMKII beta Antibody [NBP1-88212] - Electropherogram image of the cor...
Immunofluorescence (IF) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
Immunofluorescence (IF) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
 image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) In vivo assay: CaMKII beta Antibody [NBP1-88212] - Lane 1: NIH-3T3 cell lysate (Mouse...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human ...
Immunofluorescence (IF) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
Simple Western (SimWes) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Simple Western: CaMKII beta Antibody [NBP1-88212] - Simple Western lane view shows a ...
Immunofluorescence (IF) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunocytochemistry/Immunofluorescence: CaMKII beta Antibody [NBP1-88212] - Staining ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human ...
Western Blotting (WB) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Western Blot: CaMKII beta Antibody [NBP1-88212] - Lane 1: Marker [kDa] 250, 130, 100,...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry-Paraffin: CaMKII beta Antibody - Staining of human placenta sho...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry-Paraffin: CaMKII beta Antibody - Staining of human cerebellum s...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry-Paraffin: CaMKII beta Antibody - Staining of human heart shows ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry-Paraffin: CaMKII beta Antibody - Staining of mouse brain shows ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Calcium/calmodulin-Dependent Protein Kinase (CaM Kinase) II beta (CAMK2B) antibody (ABIN4287584) Immunohistochemistry-Paraffin: CaMKII beta Antibody - Staining of human cerebral cor...