anti-Mouse (Murine) FZD4 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended FZD4 Antibody (supplied by: Log in to see )

Frizzled Family Receptor 4 (FZD4) Antibodies
  • CG4626
  • DFz4
  • Dfz4
  • Dm Fz4
  • Dmel\\CG4626
  • Fz4
  • anon-WO0170980.10
  • anon-WO0170980.11
  • fz1
  • zg01
  • CD344
  • EVR1
  • FEVR
  • FZD4S
  • Fz-4
  • FzE4
  • GPCR
  • hFz4
  • frizzled4
  • fz4
  • FZ-4
  • frizzled 4
  • frizzled class receptor 4
  • frizzled-4
  • frizzled class receptor 4 S homeolog
  • fz4
  • fzd4
  • Tsp_10376
  • FZD4
  • Fzd4
  • fzd4.S
Human, Mouse (Murine), Rat (Rattus)
This FZD4 antibody is un-conjugated
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN5708436
$ 452.38
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
8.58412 ABIN1714167 IF (p) IHC (p) WB Rabbit IgG AA 190-222 Log in to see Polyclonal 0
7 ABIN6747066 IHC IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal 0
7 ABIN1048624 IHC IHC (p) Rabbit C-Term Log in to see Polyclonal 0
5.4582005 ABIN4312597 IHC (p) Rabbit C-Term Log in to see Polyclonal 0
1 ABIN1711682 IHC (p) WB HRP Rabbit IgG AA 190-222 Log in to see Polyclonal 0
1 ABIN1700665 IHC (p) WB Biotin Rabbit IgG AA 190-222 Log in to see Polyclonal 0
1 ABIN5556828 IHC (p) Rabbit C-Term Log in to see Polyclonal 0
1 ABIN5960839 ELISA IHC (p) Rabbit IgG Log in to see Polyclonal 0


Antigen Frizzled Family Receptor 4 (FZD4) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(152), (108), (57), (6), (6), (5), (5), (5), (4), (4), (3), (3), (3), (2), (1)
Host Rabbit
(130), (27), (13), (8)
Conjugate This FZD4 antibody is un-conjugated
(12), (7), (7), (7), (5), (5), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(120), (68), (39), (16), (15), (13), (12), (6), (4), (2), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-FZD4 Antibody

Target Details FZD4 Application Details Handling Images
Purification Antigen affinity purified
Immunogen Amino acids QNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQY from the human protein were used as the immunogen for the FZD4 antibody.
Isotype IgG
Plasmids, Primers & others

Target Details FZD4

Product Details anti-FZD4 Antibody Application Details Handling Images back to top
Alternative Name Frizzled 4 / FZD4 (FZD4 Antibody Abstract)
Background Frizzled-4 is a protein that in humans is encoded by the FZD4 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.
UniProt Q9ULV1
Pathways WNT Signaling, Hormone Transport, Sensory Perception of Sound

Application Details

Product Details anti-FZD4 Antibody Target Details FZD4 Handling Images back to top
Application Notes Optimal dilution of the FZD4 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL
Restrictions For Research Use only


Product Details anti-FZD4 Antibody Target Details FZD4 Application Details Images back to top
Buffer 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
Storage -20 °C
Storage Comment After reconstitution, the FZD4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.


Product Details anti-FZD4 Antibody Target Details FZD4 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Frizzled Family Receptor 4 (FZD4) antibody (ABIN5708436) Western blot testing of human 1) placenta and 2) MCF7 lysate with FZD4 antibody at 0....
Immunohistochemistry (IHC) image for anti-Frizzled Family Receptor 4 (FZD4) antibody (ABIN5708436) IHC testing of FFPE human lung cancer tissue with FZD4 antibody at 1ug/ml. Required H...
Immunohistochemistry (IHC) image for anti-Frizzled Family Receptor 4 (FZD4) antibody (ABIN5708436) IHC testing of FFPE mouse heart tissue with FZD4 antibody at 1ug/ml. Required HIER: s...
Immunohistochemistry (IHC) image for anti-Frizzled Family Receptor 4 (FZD4) antibody (ABIN5708436) IHC testing of FFPE rat heart tissue with FZD4 antibody at 1ug/ml. Required HIER: ste...