Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN486791

V-Myc Myelocytomatosis Viral Oncogene Homolog (Avian) (MYC) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MRTL, MYCC, bHLHe39, c-Myc, CMYC, c-myc, RNCMYC, mMyc, C-MYC, MYC, cmyc, zc-myc, AU016757, Myc2, Niard, Nird, LOC100136746
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN486791
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MYC antibody: synthetic peptide directed towards the N terminal of human MYC
Sequence QPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTP PLSPSRRSGL
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Sheep : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against MYC. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MYC
Background MYC is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this MYC gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma.The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene. The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene.
Molecular Weight 50kDa
Gene ID 4609
NCBI Accession NP_002458, NM_002467
UniProt P01106-2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MYC antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Zhu, Blenis, Yuan: "Activation of PI3K/Akt and MAPK pathways regulates Myc-mediated transcription by phosphorylating and promoting the degradation of Mad1." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 105, Issue 18, pp. 6584-9, 2008 (PubMed).

Alternatives for antigen "V-Myc Myelocytomatosis Viral Oncogene Homolog (Avian) (MYC)", type "Antibodies"
Hosts (294), (156), (19), (17), (4), (4)
Reactivities (436), (195), (167), (28), (26), (25), (25), (20), (14), (7), (6), (5), (5), (5), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applications (345), (155), (127), (123), (114), (85), (50), (50), (42), (21), (10), (8), (7), (7), (3), (1), (1)
Conjugates (29), (24), (18), (7), (5), (5), (5), (5), (5), (5), (5), (5), (2), (1), (1), (1), (1), (1)
Epitopes (43), (41), (33), (32), (25), (18), (11), (10), (8), (6), (5), (5), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Beacon