anti-Mouse (Murine) PRKAG2 antibody for Immunocytochemistry

Recommended PRKAG2 Antibody (supplied by: Log in to see )

Antigen
Protein Kinase, AMP-Activated, gamma 2 Non-Catalytic Subunit (PRKAG2) Antibodies
  • MGC82938
  • PRKAG2
  • si:ch211-230l11.1
  • si:dkey-217f4.2
  • AAKG
  • AAKG2
  • CMH6
  • H91620p
  • WPWS
  • 2410051C13Rik
  • AI854673
  • protein kinase AMP-activated non-catalytic subunit gamma 2
  • protein kinase, AMP-activated, gamma 2 non-catalytic subunit L homeolog
  • 5'-AMP-activated protein kinase subunit gamma-2
  • protein kinase, AMP-activated, gamma 2 non-catalytic subunit b
  • protein kinase, AMP-activated, gamma 2 non-catalytic subunit
  • Prkag2
  • PRKAG2
  • prkag2.L
  • LOC504219
  • prkag2b
  • prkag2
Reactivity
Human, Mouse (Murine), Rat (Rattus)
43
21
6
3
Host
Rabbit
42
6
Clonality
Polyclonal
Conjugate
This PRKAG2 antibody is un-conjugated
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
42
22
17
16
9
6
6
2
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4347313
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1860315 ICC IHC WB Rabbit IgG AA 290-508 Log in to see Polyclonal 0
1 ABIN5622552 ICC IF WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen Protein Kinase, AMP-Activated, gamma 2 Non-Catalytic Subunit (PRKAG2) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(43), (21), (6), (3)
Host Rabbit
(42), (6)
Clonality
Polyclonal
Conjugate This PRKAG2 antibody is un-conjugated
(1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(42), (22), (17), (16), (9), (6), (6), (2), (2), (1)
Pubmed 3 references available
Supplier Log in to see

Product Details anti-PRKAG2 Antibody

Target Details PRKAG2 Application Details Handling References for anti-PRKAG2 antibody (ABIN4347313) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:STPTQVTKQHTFPLESYKHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAALGPAEAGMLEKLEFEDEAVEDSESGVYMRFMRSHK
Isotype IgG
Plasmids, Primers & others

Target Details PRKAG2

Product Details anti-PRKAG2 Antibody Application Details Handling References for anti-PRKAG2 antibody (ABIN4347313) Images back to top
Antigen
Alternative Name PRKAG2 (PRKAG2 Antibody Abstract)
Background Gene Symbol: PRKAG2
Gene ID 51422
Pathways AMPK Signaling, Cellular Glucan Metabolic Process, Ribonucleoside Biosynthetic Process, Regulation of Carbohydrate Metabolic Process

Application Details

Product Details anti-PRKAG2 Antibody Target Details PRKAG2 Handling References for anti-PRKAG2 antibody (ABIN4347313) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-PRKAG2 Antibody Target Details PRKAG2 Application Details References for anti-PRKAG2 antibody (ABIN4347313) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-PRKAG2 antibody (ABIN4347313)

Product Details anti-PRKAG2 Antibody Target Details PRKAG2 Application Details Handling Images back to top
Product cited in:

Pinter, Jefferson, Czibik, Watkins, Redwood: "Subunit composition of AMPK trimers present in the cytokinetic apparatus: Implications for drug target identification." in: Cell cycle (Georgetown, Tex.), Vol. 11, Issue 5, pp. 917-21, 2012

Martiáñez, Francès, López: "Generation of digital responses in stress sensors." in: The Journal of biological chemistry, Vol. 284, Issue 36, pp. 23902-11, 2009

Tobias, Lazauskas, Arevalo, Bagley, Brown, Galpin: "Fiber type-specific analysis of AMPK isoforms in human skeletal muscle: advancement in methods via capillary nano-immunoassay." in: Journal of applied physiology (Bethesda, Md. : 1985), 1970 (Sample species: Human).

Images

Product Details anti-PRKAG2 Antibody Target Details PRKAG2 Application Details Handling References for anti-PRKAG2 antibody (ABIN4347313) back to top
Supplier Images
Immunofluorescence (IF) image for anti-Protein Kinase, AMP-Activated, gamma 2 Non-Catalytic Subunit (PRKAG2) antibody (ABIN4347313) Immunocytochemistry/Immunofluorescence: PRKAG2 Antibody [NBP1-89324] - Staining of hu...
Western Blotting (WB) image for anti-Protein Kinase, AMP-Activated, gamma 2 Non-Catalytic Subunit (PRKAG2) antibody (ABIN4347313) Western Blot: PRKAG2 Antibody [NBP1-89324] - Lane 1: Marker [kDa] 230, 110, 82, 49, 3...
Western Blotting (WB) image for anti-Protein Kinase, AMP-Activated, gamma 2 Non-Catalytic Subunit (PRKAG2) antibody (ABIN4347313) Western Blot: PRKAG2 Antibody [NBP1-89324] - Lane 1: NIH-3T3 cell lysate (Mouse embry...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Protein Kinase, AMP-Activated, gamma 2 Non-Catalytic Subunit (PRKAG2) antibody (ABIN4347313) Immunohistochemistry-Paraffin: PRKAG2 Antibody [NBP1-89324] - Staining of human rectu...
Western Blotting (WB) image for anti-Protein Kinase, AMP-Activated, gamma 2 Non-Catalytic Subunit (PRKAG2) antibody (ABIN4347313) Western Blot: PRKAG2 Antibody - Western blot analysis in mouse cell line NIH-3T3, ra...
Immunofluorescence (IF) image for anti-Protein Kinase, AMP-Activated, gamma 2 Non-Catalytic Subunit (PRKAG2) antibody (ABIN4347313) Immunocytochemistry/Immunofluorescence: PRKAG2 Antibody - Immunofluorescent staining...