CDC25C antibody (C-Term)
-
- Target See all CDC25C Antibodies
- CDC25C (Cell Division Cycle 25 Homolog C (S. Pombe) (CDC25C))
-
Binding Specificity
- AA 435-473, C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CDC25C antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for M-phase inducer phosphatase 3(CDC25C) detection. Tested with WB in Human.
- Sequence
- MHHQDHKTEL LRCRSQSKVQ EGERQLREQI ALLVKDMSP
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for M-phase inducer phosphatase 3(CDC25C) detection. Tested with WB in Human.
Gene Name: cell division cycle 25C
Protein Name: M-phase inducer phosphatase 3 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human Cdc25C (435-473aa MHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP), different from the related mouse sequence by ten amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product CDC25C Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Prostate cancer cell proliferation is suppressed by microRNA-3160-5p via targeting of F-box and WD repeat domain containing 8." in: Oncology letters, Vol. 15, Issue 6, pp. 9436-9442, (2018) (PubMed).
: "
-
Prostate cancer cell proliferation is suppressed by microRNA-3160-5p via targeting of F-box and WD repeat domain containing 8." in: Oncology letters, Vol. 15, Issue 6, pp. 9436-9442, (2018) (PubMed).
-
- Target
- CDC25C (Cell Division Cycle 25 Homolog C (S. Pombe) (CDC25C))
- Alternative Name
- CDC25C (CDC25C Products)
- Synonyms
- CDC25C antibody, cdc25 antibody, xcdc25c antibody, CDC25 antibody, PPP1R60 antibody, Cdc25 antibody, cdc25-3 antibody, xcdc25-3 antibody, cell division cycle 25C antibody, cell division cycle 25C S homeolog antibody, CDC25C antibody, cdc25c antibody, Cdc25c antibody, cdc25c.S antibody
- Background
-
M-phase inducer phosphatase 3 is an enzyme that in humans is encoded by the CDC25C gene. This gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 (CDK1) and triggers entry into mitosis. Also, it is thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.
Synonyms: CDC 25 antibody|Cdc 25C antibody|CDC25 antibody|CDC25C antibody|Cell division cycle 25 homolog C antibody|Cell division cycle 25C antibody|Cell division cycle 25C protein antibody|Dual specificity phosphatase Cdc25C antibody|M phase inducer phosphatase 3 antibody| M-phase inducer phosphatase 3 antibody|Mitosis inducer CDC25 antibody|MPIP3 antibody|MPIP3_HUMAN antibody|Phosphotyrosine phosphatase antibody|PPP1R60 antibody|protein phosphatase 1, regulatory subunit 60 antibody - Gene ID
- 995
- UniProt
- P30307
- Pathways
- Cell Division Cycle, M Phase
-