CDK6 antibody (N-Term)

Catalog No. ABIN4886534

Product Details anti-CDK6 Antibody

Target: CDK6 (Cyclin-Dependent Kinase 6 (CDK6))

Binding Specificity: AA 119-150, N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDK6 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Cyclin-dependent kinase 6(CDK6) detection. Tested with WB in Human,Rat.

Sequence: TETIKDMMFQ LLRGLDFLHS HRVVHRDLKP QN

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Cyclin-dependent kinase 6(CDK6) detection. Tested with WB in Human,Rat.
Gene Name: cyclin-dependent kinase 6
Protein Name: Cyclin-dependent kinase 6

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Cdk6 (119-150aa TETIKDMMFQLLRGLDFLHSHRVVHRDLKPQN), identical to the related mouse sequence.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-CDK6 antibody (ABIN4886534)

Ren, Qiu, Lü, Ru, Li, Xiang, Yu, Zhang: "TALENs-directed knockout of the full-length transcription factor Nrf1α that represses malignant behaviour of human hepatocellular carcinoma (HepG2) cells." in: Scientific reports, Vol. 6, pp. 23775, (2017) (PubMed).

Li, Chen, Chen, Mo, Li, Xiao, Yu, Guo: "Circular RNA 0000096 affects cell growth and migration in gastric cancer." in: British journal of cancer, Vol. 116, Issue 5, pp. 626-633, (2017) (PubMed).

Wang, Wu, Zhou, Jin, He, Yu, Xuan, Wang, Tian, Sun, Liu, Qu: "Long noncoding RNA NEAT1 promotes laryngeal squamous cell cancer through regulating miR-107/CDK6 pathway." in: Journal of experimental & clinical cancer research : CR, Vol. 35, pp. 22, (2016) (PubMed).

Zhou, Lu, Liu, Guo, Liu, Zhou, Yang, Mi, Xu: "Platycodin D induces tumor growth arrest by activating FOXO3a expression in prostate cancer in vitro and in vivo." in: Current cancer drug targets, Vol. 14, Issue 9, pp. 860-71, (2015) (PubMed).

Target Details for CDK6

Target: CDK6 (Cyclin-Dependent Kinase 6 (CDK6))

Alternative Name: CDK6 (CDK6 Products)

Synonyms: CDK6 antibody, PLSTIRE antibody, 5830411I20 antibody, AI504062 antibody, Crk2 antibody, cyclin dependent kinase 6 antibody, cyclin-dependent kinase 6 antibody, CDK6 antibody, Cdk6 antibody

Background: Cell division protein kinase 6, also called Plstire, is an enzyme that in humans is encoded by the CDK6 gene. The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. Radiation hybrid analysis and inclusion within a mapped clone place the CDK6 gene at 7q21. Serine/threonine-protein kinase involved in the control of the cell cycle and differentiation and promotes G1/S transition. This gene also involved in initiation and maintenance of cell cycle exit during cell differentiation. It prevents cell proliferation and regulates negatively cell differentiation, but is required for the proliferation of specific cell types. In addition, CDK6 plays a role in promoting the proliferation of beta-cells in pancreatic islets of Langerhans.

Synonyms: CDK6 | CDKN6 | PLSTIRE | STQTL11 | Q00534

Gene ID: 1021

UniProt: Q00534

Pathways: Cell Division Cycle, Mitotic G1-G1/S Phases