KCNQ1 antibody (Middle Region)

Catalog No. ABIN4886647

Product Details anti-KCNQ1 Antibody

Target: KCNQ1 (Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 1 (KCNQ1))

Binding Specificity: AA 356-397, Middle Region

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNQ1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily KQT member 1(KCNQ1) detection. Tested with WB in Human,Rat.

Sequence: QQKQRQKHFN RQIPAAASLI QTAWRCYAAE NPDSSTWKIY IR

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily KQT member 1(KCNQ1) detection. Tested with WB in Human,Rat.
Gene Name: potassium voltage-gated channel subfamily Q member 1
Protein Name: Potassium voltage-gated channel subfamily KQT member 1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human KCNQ1 (356-397aa QQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSSTWKIYIR), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for KCNQ1

Target: KCNQ1 (Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 1 (KCNQ1))

Alternative Name: KCNQ1 (KCNQ1 Products)

Synonyms: ATFB1 antibody, ATFB3 antibody, JLNS1 antibody, KCNA8 antibody, KCNA9 antibody, KVLQT1 antibody, Kv1.9 antibody, Kv7.1 antibody, LQT antibody, LQT1 antibody, RWS antibody, SQT2 antibody, WRS antibody, CG12215 antibody, CG12915 antibody, CG33135 antibody, DKCNQ antibody, Dmel\\CG33135 antibody, dKCNQ antibody, kcnq1 antibody, KCNQ1 antibody, kqt-3 antibody, kv7.1 antibody, Kvlqt1 antibody, KvLQT-1 antibody, kcnq1-A antibody, xkvlqt1 antibody, zgc:158384 antibody, AW559127 antibody, Kcna9 antibody, KvLQT1 antibody, potassium voltage-gated channel subfamily Q member 1 antibody, KCNQ potassium channel antibody, potassium voltage-gated channel, KQT-like subfamily, member 1 antibody, potassium channel, voltage gated KQT-like subfamily Q, member 1 antibody, voltage gated potassium channel subunit antibody, potassium channel, voltage gated KQT-like subfamily Q, member 1 L homeolog antibody, potassium voltage-gated channel, subfamily Q, member 1 antibody, KCNQ1 antibody, KCNQ antibody, kcnq1 antibody, Kcnq1 antibody, kcnq1.L antibody

Background: Kv7.1 (KvLQT1) is a potassium channel protein whose primary subunit in humans is encoded by the KCNQ1 gene. This protein can form heteromultimers with two other potassium channel proteins, KCNE1 and KCNE3. Mutations in this gene are associated with hereditary long QT syndrome 1 (also known as Romano-Ward syndrome), Jervell and Lange-Nielsen syndrome, and familial atrial fibrillation. This gene exhibits tissue-specific imprinting, with preferential expression from the maternal allele in some tissues, and biallelic expression in others. And this gene is located in a region of chromosome 11 amongst other imprinted genes that are associated with Beckwith-Wiedemann syndrome (BWS), and itself has been shown to be disrupted by chromosomal rearrangements in patients with BWS. Alternatively spliced transcript variants have been found for this gene.

Synonyms: ATFB1 | ATFB3 | JLNS1 | KCNA8 | KCNA9 | KCNQ1 | Kv1.9 | Kv7.1 | KVLQT1 | LQT | LQT1 | RWS | SQT2 | WRS | P51787

Gene ID: 3784

UniProt: P51787

Pathways: Negative Regulation of Hormone Secretion, Sensory Perception of Sound