NEDD8 antibody (Middle Region)
-
- Target See all NEDD8 Antibodies
- NEDD8 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 8 (NEDD8))
-
Binding Specificity
- AA 20-60, Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NEDD8 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for NEDD8(NEDD8) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- TDKVERIKER VEEKEGIPPQ QQRLIYSGKQ MNDEKTAADY K
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for NEDD8(NEDD8) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: neural precursor cell expressed, developmentally down-regulated 8
Protein Name: NEDD8 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human NEDD8 (20-60aa TDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product NEDD8 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- NEDD8 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 8 (NEDD8))
- Alternative Name
- NEDD8 (NEDD8 Products)
- Synonyms
- NEDD-8 antibody, Rub1 antibody, CG10679 antibody, Dmel\\CG10679 antibody, NEDD8 antibody, dNEDD8 antibody, nedd8 antibody, ubiquitin antibody, si:zc14a17.5 antibody, GB17785 antibody, DDBDRAFT_0218116 antibody, DDBDRAFT_0238041 antibody, DDB_0218116 antibody, DDB_0238041 antibody, nedd8.S antibody, neural precursor cell expressed, developmentally down-regulated 8 antibody, neural precursor cell expressed, developmentally down-regulated gene 8 antibody, CG10679 gene product from transcript CG10679-RB antibody, Nedd8 antibody, ubiquitin-like protein Nedd8 antibody, neural precursor cell expressed, developmentally down-regulated 8 L homeolog antibody, NEDD8 antibody, Nedd8 antibody, nedd8 antibody, nedd8.L antibody
- Background
-
NEDD8 is a protein that in humans is encoded by the NEDD8 gene. Human NEDD8 shares 60 % amino acid sequence identity to ubiquitin. The most substrates of NEDD8 modification are the Cullin subunits of Cullin-based E3 ubiquitin ligases, which are active only when neddylated. Their NEDDylation is critical for the recruitment of E2 to the ligase complex, thus facilitating ubiquitin conjugation. NEDD8 modification has therefore been implicated in cell cycle progression and cytoskeletal regulation.
Synonyms: NED8 | NEDD 8 | NEDD-8 | Nedd8 | Neddylin | Rub1 | Q15843 - Gene ID
- 4738
- UniProt
- Q15843
- Pathways
- Ubiquitin Proteasome Pathway
-