Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

AIF antibody

AIFM1 Reactivity: Human, Mouse, Rat WB, IHC (p), ICC Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN4950058
  • Target See all AIF (AIFM1) Antibodies
    AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))
    Reactivity
    • 103
    • 55
    • 53
    • 22
    • 10
    • 8
    • 7
    • 7
    • 7
    • 5
    • 4
    • 3
    • 3
    • 1
    • 1
    • 1
    Human, Mouse, Rat
    Host
    • 92
    • 9
    • 2
    • 2
    Rabbit
    Clonality
    • 87
    • 17
    Polyclonal
    Conjugate
    • 70
    • 5
    • 5
    • 4
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    This AIF antibody is un-conjugated
    Application
    • 92
    • 39
    • 36
    • 29
    • 26
    • 15
    • 14
    • 13
    • 13
    • 8
    • 6
    • 4
    • 2
    • 2
    • 2
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunocytochemistry (ICC)
    Purification
    Antigen affinity
    Immunogen
    Amino acids FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED of human AIF were used as the immunogen for the AIF antibody.
    Isotype
    IgG
    Top Product
    Discover our top product AIFM1 Primary Antibody
  • Application Notes
    Optimal dilution of the AIF antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,ICC: 0.5-1 μg/mL
    Restrictions
    For Research Use only
  • Buffer
    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
    Storage
    -20 °C
    Storage Comment
    After reconstitution, the AIF antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Target
    AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))
    Alternative Name
    AIFM1 (AIFM1 Products)
    Synonyms
    AIF antibody, CMTX4 antibody, COWCK antibody, COXPD6 antibody, PDCD8 antibody, CG7263 antibody, DmAIF antibody, Dmel\\CG7263 antibody, GB16024 antibody, DDBDRAFT_0187853 antibody, DDBDRAFT_0191137 antibody, DDB_0187853 antibody, DDB_0191137 antibody, aif antibody, pdcd8 antibody, AIFM1 antibody, PCD8 antibody, AIFsh2 antibody, Hq antibody, Pdcd8 antibody, mAIF antibody, Aif antibody, zgc:91994 antibody, apoptosis inducing factor mitochondria associated 1 antibody, allograft inflammatory factor 1 antibody, Apoptosis inducing factor antibody, apoptosis-inducing factor 1, mitochondrial antibody, apoptosis inducing factor antibody, apoptosis inducing factor, mitochondria associated 1 antibody, apoptosis-inducing factor, mitochondrion-associated, 1 antibody, apoptosis-inducing factor, mitochondrion-associated 1 antibody, AIFM1 antibody, AIF1 antibody, AIF antibody, LOC412212 antibody, aif antibody, aifm1 antibody, Aifm1 antibody
    Background
    Apoptosis-inducing factor 1, mitochondrial, also known as AIF or PDCD8 is a protein that in humans is encoded by the AIFM1 gene. AIFM1 gene is mapped to Xq26.1 based on an alignment of the AIFM1 sequence with the genomic sequence. This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, and it is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Mutations in this gene cause combined oxidative phosphorylation deficiency 6, which results in a severe mitochondrial encephalomyopathy. A related pseudogene has been identified on chromosome 10.
    UniProt
    O95831
    Pathways
    Apoptosis, Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis, Smooth Muscle Cell Migration, Warburg Effect
You are here:
Support