APH1A antibody

Catalog No. ABIN4950145

Product Details anti-APH1A Antibody

Target: APH1A (Anterior Pharynx Defective 1 Homolog A (C. Elegans) (APH1A))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APH1A antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids LRSIQRSLLCRRQEDSRVMVYSALRIPPED of human APH1A were used as the immunogen for the APH1A antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the APH1A antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the APH1A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for APH1A

Target: APH1A (Anterior Pharynx Defective 1 Homolog A (C. Elegans) (APH1A))

Alternative Name: APH1A (APH1A Products)

Synonyms: 6530402N02Rik antibody, APH-1 antibody, APH-1A antibody, CGI-78 antibody, RGD1311546 antibody, APH-1a antibody, aph-1 homolog A, gamma-secretase subunit antibody, aph-1 homolog A, gamma secretase subunit L homeolog antibody, aph-1 homolog A, gamma secretase subunit antibody, anterior pharynx defective 1 homolog A (C. elegans) antibody, aph1 homolog A, gamma secretase subunit antibody, acylamino-acid-releasing enzyme-like antibody, APH1A antibody, aph1a.L antibody, Aph1a antibody, LOC100219182 antibody

Background: APH1A encodes a component of the gamma secretase complex that cleaves integral membrane proteins such as Notch receptors and beta-amyloid precursor protein. The gamma secretase complex contains this gene product, or the paralogous anterior pharynx defective 1 homolog B (APH1B), along with the presenilin, nicastrin, and presenilin enhancer-2 proteins. The precise function of this seven-transmembrane-domain protein is unknown though it is suspected of facilitating the association of nicastrin and presenilin in the gamma secretase complex as well as interacting with substrates of the gamma secretase complex prior to their proteolytic processing. Polymorphisms in a promoter region of this gene have been associated with an increased risk for developing sporadic Alzheimer's disease. Alternative splicing results in multiple protein-coding and non-protein-coding transcript variants.

UniProt: Q96BI3

Pathways: Notch Signaling, Neurotrophin Signaling Pathway