CPT1B antibody

Catalog No. ABIN4950637

Product Details anti-CPT1B Antibody

Target: CPT1B (Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPT1B antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (Frozen Sections) (IHC (fro))

Purification: Antigen affinity

Immunogen: Amino acids DDEEYYRMELLAKEFQDKTAPRLQKYLVLK of human CPT1B were used as the immunogen for the CPT1B antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the CPT1B antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,IHC (Frozen): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the CPT1B antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for CPT1B

Target: CPT1B (Carnitine Palmitoyltransferase 1B (Muscle) (CPT1B))

Alternative Name: CPT1B (CPT1B Products)

Synonyms: CPT1-M antibody, CPT1M antibody, CPTI antibody, CPTI-M antibody, M-CPT1 antibody, MCCPT1 antibody, MCPT1 antibody, CPT-IB antibody, M-CPTI antibody, CPT1 antibody, CPTIB antibody, cpt1al antibody, zgc:103709 antibody, CPT1B antibody, MGC147544 antibody, Cpt1 antibody, Cpt1-m antibody, Cpti antibody, Cpti-m antibody, M-cpti antibody, carnitine palmitoyltransferase 1B antibody, carnitine palmitoyltransferase 1B (muscle) antibody, carnitine palmitoyltransferase 1B L homeolog antibody, carnitine palmitoyltransferase 1b, muscle antibody, CPT1B antibody, Cpt1b antibody, cpt1b antibody, cpt1b.L antibody

Background: CPT1B is located on 22q13.33. The protein encoded by this gene, a member of the carnitine/ choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene.

UniProt: Q92523

Pathways: AMPK Signaling, Monocarboxylic Acid Catabolic Process