NR3C2 antibody

Catalog No. ABIN4951773

Product Details anti-NR3C2 Antibody

Target: NR3C2 (Nuclear Receptor Subfamily 3, Group C, Member 2 (NR3C2))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NR3C2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids HALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK of the human protein were used as the immunogen for the MR antibody. This sequence is common to isoforms 1, 3 and 4.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the MR antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the MR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for NR3C2

Target: NR3C2 (Nuclear Receptor Subfamily 3, Group C, Member 2 (NR3C2))

Alternative Name: Mineralocorticoid Receptor / MR (NR3C2 Products)

Synonyms: mr antibody, si:ch211-189l17.1 antibody, LOC100302443 antibody, NR3C2 antibody, LOC443144 antibody, MLR antibody, MR antibody, MCR antibody, NR3C2VIT antibody, Mlr antibody, mlr antibody, nuclear receptor subfamily 3, group C, member 2 antibody, nuclear receptor subfamily 3 group C member 2 antibody, mineralocorticoid receptor antibody, nuclear receptor subfamily 3 group C member 2 L homeolog antibody, nr3c2 antibody, NR3C2 antibody, LOC443144 antibody, Nr3c2 antibody, nr3c2.L antibody

Background: NR3C2 (nuclear receptor subfamily 3, group C, member 2), also known as MR (mineralocorticoid receptor), is a protein that in humans is encoded by the NR3C2 gene that is located on chromosome 4q31.1-31.2. It belongs to the nuclear receptor family where the ligand diffuses into cells, interacts with the receptor and results in a signal transduction affecting specific gene expression in the nucleus. This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants.

UniProt: P08235

Pathways: ACE Inhibitor Pathway, Nuclear Receptor Transcription Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway