BAX antibody (N-Term)
-
- Target See all BAX Antibodies
- BAX (BCL2-Associated X Protein (BAX))
-
Binding Specificity
- AA 17-48, N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BAX antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Apoptosis regulator BAX(BAX) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- EQIMKTGALL LQGFIQDRAG RMGGEAPELA LD
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Apoptosis regulator BAX(BAX) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: BCL2-associated X protein
Protein Name: Apoptosis regulator BAX - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17-48aa EQIMKTGALLLQGFIQDRAGRMGGEAPELALD), different from the related mouse and rat sequences by five amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product BAX Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
A novel polysaccharide from Sargassum integerrimum induces apoptosis in A549 cells and prevents angiogensis in vitro and in vivo." in: Scientific reports, Vol. 6, pp. 26722, (2018) (PubMed).
: "BMP‑7 suppresses excessive scar formation by activating the BMP‑7/Smad1/5/8 signaling pathway." in: Molecular medicine reports, Vol. 16, Issue 2, pp. 1957-1963, (2018) (PubMed).
: "Active targeting co-delivery system based on hollow mesoporous silica nanoparticles for antitumor therapy in ovarian cancer stem-like cells." in: Oncology reports, Vol. 38, Issue 3, pp. 1442-1450, (2018) (PubMed).
: "Emodin alleviates severe acute pancreatitis-associated acute lung injury by decreasing pre-B-cell colony-enhancing factor expression and promoting polymorphonuclear neutrophil apoptosis." in: Molecular medicine reports, Vol. 16, Issue 4, pp. 5121-5128, (2018) (PubMed).
: "Ailanthone induces G2/M cell cycle arrest and apoptosis of SGC‑7901 human gastric cancer cells." in: Molecular medicine reports, Vol. 16, Issue 5, pp. 6821-6827, (2018) (PubMed).
: "Fibroblast growth factor 21 protects rat cardiomyocytes from endoplasmic reticulum stress by promoting the fibroblast growth factor receptor 1-extracellular signal‑regulated kinase 1/2 signaling ..." in: International journal of molecular medicine, Vol. 40, Issue 5, pp. 1477-1485, (2018) (PubMed).
: "Magnesium isoglycyrrhizinate ameliorates doxorubicin-induced acute cardiac and hepatic toxicity via anti-oxidant and anti-apoptotic mechanisms in mice." in: Experimental and therapeutic medicine, Vol. 15, Issue 1, pp. 1005-1012, (2018) (PubMed).
: "Down-regulation of long non-coding RNA ESCCAL_1 inhibits tumor growth of esophageal squamous cell carcinoma in a xenograft mouse model." in: Oncotarget, Vol. 9, Issue 1, pp. 783-790, (2018) (PubMed).
: "Replication of hepatitis E virus in the ovary and promotion of oocyte apoptosis in rabbits infected with HEV-4." in: Oncotarget, Vol. 9, Issue 4, pp. 4475-4484, (2018) (PubMed).
: "Effects of 5-hydroxy-4'-nitro-7-propionyloxy-genistein on inhibiting proliferation and invasion via activating reactive oxygen species in human ovarian cancer A2780/DDP cells." in: Oncology letters, Vol. 15, Issue 4, pp. 5227-5235, (2018) (PubMed).
: "Hepatitis E Virus Induces Hepatocyte Apoptosis via Mitochondrial Pathway in Mongolian Gerbils." in: Frontiers in microbiology, Vol. 9, pp. 460, (2018) (PubMed).
: "Ginsenoside Rb1 inhibit apoptosis in rat model of Alzheimer's disease induced by Aβ1-40." in: American journal of translational research, Vol. 10, Issue 3, pp. 796-805, (2018) (PubMed).
: "Ginkgolic acids induce HepG2 cell death via a combination of apoptosis, autophagy and the mitochondrial pathway." in: Oncology letters, Vol. 15, Issue 5, pp. 6400-6408, (2018) (PubMed).
: "Yangyin Fuzheng Decoction enhances anti-tumor efficacy of cisplatin on lung cancer." in: Journal of Cancer, Vol. 9, Issue 9, pp. 1568-1574, (2018) (PubMed).
: "Di-2-pyridylhydrazone Dithiocarbamate Butyric Acid Ester Exerted Its Proliferative Inhibition against Gastric Cell via ROS-Mediated Apoptosis and Autophagy." in: Oxidative medicine and cellular longevity, Vol. 2018, pp. 4950705, (2018) (PubMed).
: "Catalpol inhibits apoptosis in hydrogen peroxide-induced cardiac myocytes through a mitochondrial-dependent caspase pathway." in: Bioscience reports, Vol. 36, Issue 3, (2017) (PubMed).
: "Knockdown of High Mobility Group-Box 3 (HMGB3) Expression Inhibits Proliferation, Reduces Migration, and Affects Chemosensitivity in Gastric Cancer Cells." in: Medical science monitor : international medical journal of experimental and clinical research, Vol. 22, pp. 3951-3960, (2017) (PubMed).
: "Inhibition by Multifunctional Magnetic Nanoparticles Loaded with Alpha-Synuclein RNAi Plasmid in a Parkinson's Disease Model." in: Theranostics, Vol. 7, Issue 2, pp. 344-356, (2017) (PubMed).
: "Thymic cytoarchitecture changes in mice exposed to vanadium." in: Journal of immunotoxicology, Vol. 14, Issue 1, pp. 9-14, (2017) (PubMed).
: "Inhibition of cerebral ischemia/reperfusion injury-induced apoptosis: nicotiflorin and JAK2/STAT3 pathway." in: Neural regeneration research, Vol. 12, Issue 1, pp. 96-102, (2017) (PubMed).
: "
-
A novel polysaccharide from Sargassum integerrimum induces apoptosis in A549 cells and prevents angiogensis in vitro and in vivo." in: Scientific reports, Vol. 6, pp. 26722, (2018) (PubMed).
-
- Target
- BAX (BCL2-Associated X Protein (BAX))
- Alternative Name
- BAX (BAX Products)
- Synonyms
- BAX-ALPHA antibody, bax-A antibody, xBax antibody, xlbax antibody, BAX antibody, bax antibody, fj16e01 antibody, wu:fc50b10 antibody, wu:fj16e01 antibody, BCL2L4 antibody, zgc:112983 antibody, BCL2 associated X, apoptosis regulator antibody, BCL2-associated X protein L homeolog antibody, BCL2-associated X protein antibody, bcl2-associated X protein, a antibody, bcl2-associated X protein, b antibody, BAX antibody, bax.L antibody, bax antibody, baxa antibody, Bax antibody, baxb antibody
- Background
-
Apoptosis regulator BAX, also known as bcl-2-like protein 4, is a protein that in humans is encoded by the BAX gene. The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. Additionally, this protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.
Synonyms: Apoptosis regulator BAX | BAXA | Bcl2-L-4 | BCL2L4 | Bcl-2-like protein 4 | Q07812 - Gene ID
- 581
- UniProt
- Q07812
- Pathways
- p53 Signaling, PI3K-Akt Signaling, Apoptosis, Caspase Cascade in Apoptosis, Positive Regulation of Endopeptidase Activity, Unfolded Protein Response
-