Insulin antibody
-
- Target See all Insulin (INS) Antibodies
- Insulin (INS)
-
Reactivity
- Human
-
Host
- Goat
-
Clonality
- Polyclonal
-
Conjugate
- This Insulin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Sequence
- MFVNQHLCGS HLVEALYLVC GERGFFYTPK TGIVEQCCTS ICSLYQLENY CN
- Specificity
- Gives a positive signal using MBP-Insulin recombinant fusion protein by WB.
- Purification
- This antibody is epitope-affinity purified from goat antiserum.
- Immunogen
- Recombinant human Insulin (MFVNQHLCGSHLVEALYLVCGERGFFYTPKTGIVEQCCTSICSLYQLENYCN) produced in E. coli as a fusion protein.
- Isotype
- IgG
- Top Product
- Discover our top product INS Primary Antibody
-
-
- Application Notes
- Western blot 1:250-1:2,000 Immunofluorescence ND Immunohistochemistry (paraffin) ND Immunohistochemistry (frozen) ND
- Restrictions
- For Research Use only
-
- Concentration
- 3 mg/mL
- Buffer
- PBS, 20 % glycerol and 0.05 % sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C, and avoid repeated freeze-thaw cycles.
-
- Target
- Insulin (INS)
- Alternative Name
- INS (INS Products)
- Synonyms
- IDDM2 antibody, ILPR antibody, IRDN antibody, MODY10 antibody, ins1 antibody, xins antibody, ins1-a antibody, Insulin antibody, AA986540 antibody, Ins-2 antibody, InsII antibody, Mody antibody, Mody4 antibody, proinsulin antibody, zgc:109842 antibody, igf2-A antibody, ins antibody, ins-a antibody, ins-b antibody, insulin antibody, insulin precursor antibody, insulin II antibody, preproinsulin antibody, insulin L homeolog antibody, insulin S homeolog antibody, INS antibody, INS-IGF2 antibody, ins antibody, Ins antibody, PIN antibody, Ins2 antibody, ins.L antibody, ins.S antibody
- Background
- Goat polyclonal to Insulin. Insulin is a 6 kDa peptide, first synthesized as a precursor molecule, preproinsulin which is then processed into proinsulin and finally to the mature insulin. An increase in blood glucose levels during stimulates insulin release from pancreatic β cells. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake.
- Molecular Weight
- 12 kDa
- Gene ID
- 3630
- UniProt
- P01308
- Pathways
- NF-kappaB Signaling, RTK Signaling, Positive Regulation of Peptide Hormone Secretion, Peptide Hormone Metabolism, Hormone Activity, Carbohydrate Homeostasis, ER-Nucleus Signaling, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Autophagy, Negative Regulation of intrinsic apoptotic Signaling, Brown Fat Cell Differentiation, Positive Regulation of fat Cell Differentiation
-