SWAP70 antibody (N-Term)

Catalog No. ABIN629614

Product Details anti-SWAP70 Antibody

Target: SWAP70 (SWAP Switching B-Cell Complex 70kDa Subunit (SWAP70))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SWAP70 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SWAP70 antibody was raised against the N terminal of SWAP70

Purification: Purified

Immunogen: SWAP70 antibody was raised using the N terminal of SWAP70 corresponding to a region with amino acids ALEEHFRDDDEGPVSNQGYMPYLNRFILEKVQDNFDKIEFNRMCWTLCVK

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SWAP70 Blocking Peptide, catalog no. 33R-1326, is also available for use as a blocking control in assays to test for specificity of this SWAP70 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SWAP70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SWAP70

Target: SWAP70 (SWAP Switching B-Cell Complex 70kDa Subunit (SWAP70))

Alternative Name: SWAP70 (SWAP70 Products)

Synonyms: SWAP-70 antibody, 70kDa antibody, AV235546 antibody, HSPC321 antibody, swap70b antibody, zgc:63599 antibody, switching B-cell complex subunit SWAP70 antibody, SWA-70 protein antibody, SWAP switching B-cell complex 70 antibody, SWAP switching B-cell complex 70kDa subunit antibody, switching B-cell complex subunit SWAP70a antibody, SWAP70 antibody, Swap70 antibody, swap70 antibody, swap70a antibody

Background: Phosphatidylinositol 3,4,5-trisphosphate-dependent guanine nucleotide exchange factor (GEF) which, independently of RAS, transduces signals from tyrosine kinase receptors to RAC. SWAP70 also mediates signaling of membrane ruffling. It regulates the actin cytoskeleton as an effector or adapter protein in response to agonist stimulated phosphatidylinositol (3,4)-bisphosphate production and cell protrusion.

Molecular Weight: 69 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response