XRCC6 antibody (N-Term)
-
- Target See all XRCC6 Antibodies
- XRCC6 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6 (XRCC6))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This XRCC6 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- G22 P1 antibody was raised against the N terminal Of G22 1
- Purification
- Purified
- Immunogen
- G22 P1 antibody was raised using the N terminal Of G22 1 corresponding to a region with amino acids NFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVL
- Top Product
- Discover our top product XRCC6 Primary Antibody
-
-
- Application Notes
-
WB: 0.6 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
G22P1 Blocking Peptide, catalog no. 33R-6687, is also available for use as a blocking control in assays to test for specificity of this G22P1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of G20 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- XRCC6 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 6 (XRCC6))
- Alternative Name
- G22P1 (XRCC6 Products)
- Synonyms
- CTC75 antibody, CTCBF antibody, G22P1 antibody, KU70 antibody, ML8 antibody, TLAA antibody, 70kDa antibody, G22p1 antibody, Ku70 antibody, Kup70 antibody, X-ray repair cross complementing 6 antibody, ATP-dependent DNA helicase II, 70 kDa subunit antibody, X-ray repair complementing defective repair in Chinese hamster cells 6 L homeolog antibody, X-ray repair complementing defective repair in Chinese hamster cells 6 antibody, XRCC6 antibody, Bm1_41430 antibody, xrcc6.L antibody, Xrcc6 antibody
- Background
- The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.
- Molecular Weight
- 70 kDa (MW of target protein)
- Pathways
- DNA Damage Repair
-