KCTD11 antibody (N-Term)
-
- Target See all KCTD11 Antibodies
- KCTD11 (Potassium Channel Tetramerisation Domain Containing 11 (KCTD11))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCTD11 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCTD11 antibody was raised against the N terminal of KCTD11
- Purification
- Purified
- Immunogen
- KCTD11 antibody was raised using the N terminal of KCTD11 corresponding to a region with amino acids ADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPH
- Top Product
- Discover our top product KCTD11 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCTD11 Blocking Peptide, catalog no. 33R-1090, is also available for use as a blocking control in assays to test for specificity of this KCTD11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCTD11 (Potassium Channel Tetramerisation Domain Containing 11 (KCTD11))
- Alternative Name
- KCTD11 (KCTD11 Products)
- Synonyms
- KCTD11 antibody, AF465352 antibody, Ren antibody, C17orf36 antibody, KCASH1 antibody, REN antibody, REN/KCTD11 antibody, potassium channel tetramerization domain containing 11 antibody, potassium channel tetramerisation domain containing 11 antibody, KCTD11 antibody, Kctd11 antibody
- Background
- The KCTD11 gene encodes a protein that has been identified as a suppressor of Hedgehog signaling. Its inactivation might lead to a deregulation of the tumor-promoting Hedgehog pathway in medulloblastoma.
- Molecular Weight
- 26 kDa (MW of target protein)
- Pathways
- Hedgehog Signaling
-