KCNQ1 antibody (N-Term)

Catalog No. ABIN630110

Product Details anti-KCNQ1 Antibody

Target: KCNQ1 (Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 1 (KCNQ1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNQ1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCNQ1 antibody was raised against the N terminal of KCNQ1

Purification: Purified

Immunogen: KCNQ1 antibody was raised using the N terminal of KCNQ1 corresponding to a region with amino acids IVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGS

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNQ1 Blocking Peptide, catalog no. 33R-4211, is also available for use as a blocking control in assays to test for specificity of this KCNQ1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNQ1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNQ1

Target: KCNQ1 (Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 1 (KCNQ1))

Alternative Name: KCNQ1 (KCNQ1 Products)

Synonyms: ATFB1 antibody, ATFB3 antibody, JLNS1 antibody, KCNA8 antibody, KCNA9 antibody, KVLQT1 antibody, Kv1.9 antibody, Kv7.1 antibody, LQT antibody, LQT1 antibody, RWS antibody, SQT2 antibody, WRS antibody, CG12215 antibody, CG12915 antibody, CG33135 antibody, DKCNQ antibody, Dmel\\CG33135 antibody, dKCNQ antibody, kcnq1 antibody, KCNQ1 antibody, kqt-3 antibody, kv7.1 antibody, Kvlqt1 antibody, KvLQT-1 antibody, kcnq1-A antibody, xkvlqt1 antibody, zgc:158384 antibody, AW559127 antibody, Kcna9 antibody, KvLQT1 antibody, potassium voltage-gated channel subfamily Q member 1 antibody, KCNQ potassium channel antibody, potassium voltage-gated channel, KQT-like subfamily, member 1 antibody, potassium channel, voltage gated KQT-like subfamily Q, member 1 antibody, voltage gated potassium channel subunit antibody, potassium channel, voltage gated KQT-like subfamily Q, member 1 L homeolog antibody, potassium voltage-gated channel, subfamily Q, member 1 antibody, KCNQ1 antibody, KCNQ antibody, kcnq1 antibody, Kcnq1 antibody, kcnq1.L antibody

Background: KCNQ1 encodes a protein for a voltage-gated potassium channel required for the repolarization phase of the cardiac action potential. The gene product can form heteromultimers with two other potassium channel proteins, KCNE1 and KCNE3. Mutations in KCNQ1 are associated with hereditary long QT syndrome, Romano-Ward syndrome, Jervell and Lange-Nielsen syndrome and familial atrial fibrillation.

Molecular Weight: 60 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion, Sensory Perception of Sound