SLC7A8 antibody
-
- Target See all SLC7A8 Antibodies
- SLC7A8 (Solute Carrier Family 7 (Amino Acid Transporter, L-Type), Member 8 (SLC7A8))
-
Reactivity
- Human, Mouse, Rat, Zebrafish (Danio rerio), Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC7A8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- SLC7 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA
- Top Product
- Discover our top product SLC7A8 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC7A8 Blocking Peptide, catalog no. 33R-7317, is also available for use as a blocking control in assays to test for specificity of this SLC7A8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC7A8 (Solute Carrier Family 7 (Amino Acid Transporter, L-Type), Member 8 (SLC7A8))
- Alternative Name
- SLC7A8 (SLC7A8 Products)
- Synonyms
- LAT2 antibody, LPI-PC1 antibody, Lat2 antibody, Lat4 antibody, XAA2 antibody, lat2 antibody, lpi-pc1 antibody, 4F2LC-5 antibody, AA408822 antibody, si:ch211-14a17.3 antibody, si:zc14a17.3 antibody, slc7a8 antibody, solute carrier family 7 member 8 antibody, solute carrier family 7 member 8 L homeolog antibody, solute carrier family 7 (amino acid transporter, L-type), member 8 antibody, solute carrier family 7 (cationic amino acid transporter, y+ system), member 8 antibody, solute carrier family 7 (amino acid transporter light chain, L system), member 8b antibody, SLC7A8 antibody, Slc7a8 antibody, slc7a8.L antibody, slc7a8 antibody, slc7a8b antibody
- Background
- SLC7A8 is sodium-independent, high-affinity transport of large neutral amino acids. It has higher affinity for L-phenylalanine than LAT1 but lower affinity for glutamine and serine. L-alanine is transported at physiological concentrations. SLC7A8 also plays a role in basolateral (re)absorption of neutral amino acids.
- Molecular Weight
- 37 kDa (MW of target protein)
-