CYP2D6 antibody (N-Term)
-
- Target See all CYP2D6 Antibodies
- CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CYP2D6 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- CYP2 D6 antibody was raised against the N terminal of CYP2 6
- Purification
- Purified
- Immunogen
- CYP2 D6 antibody was raised using the N terminal of CYP2 6 corresponding to a region with amino acids RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLE
- Top Product
- Discover our top product CYP2D6 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CYP2D6 Blocking Peptide, catalog no. 33R-8102, is also available for use as a blocking control in assays to test for specificity of this CYP2D6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))
- Alternative Name
- CYP2D6 (CYP2D6 Products)
- Synonyms
- CPD6 antibody, CYP2D antibody, CYP2D7AP antibody, CYP2D7BP antibody, CYP2D7P2 antibody, CYP2D8P2 antibody, CYP2DL1 antibody, CYPIID6 antibody, P450-DB1 antibody, P450C2D antibody, P450DB1 antibody, CYP2D42 antibody, MGC64445 antibody, cyp2d2 antibody, cyp2d6-a antibody, CYP2D6 antibody, cytochrome P450 family 2 subfamily D member 6 antibody, cytochrome P450, family 2, subfamily D, polypeptide 6 antibody, cytochrome 2D6 antibody, cytochrome P450 family 2 subfamily D member 6 S homeolog antibody, cytochrome P450 2D6 antibody, cytochrome P450 2D6-like antibody, CYP2D6 antibody, cyp2d6-b antibody, cyp2d6.S antibody, cyp2d6 antibody, LOC100988273 antibody
- Background
- CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug, sparteine and propafenone, both anti-arrythmic drugs, and amitryptiline, an anti-depressant.
- Molecular Weight
- 55 kDa (MW of target protein)
-