M6PR antibody
-
- Target See all M6PR Antibodies
- M6PR (Mannose-6-Phosphate Receptor (Cation Dependent) (M6PR))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This M6PR antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- M6 PR antibody was raised using a synthetic peptide corresponding to a region with amino acids RLKPLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKE
- Top Product
- Discover our top product M6PR Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
M6PR Blocking Peptide, catalog no. 33R-8035, is also available for use as a blocking control in assays to test for specificity of this M6PR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of M0 R antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- M6PR (Mannose-6-Phosphate Receptor (Cation Dependent) (M6PR))
- Alternative Name
- M6PR (M6PR Products)
- Synonyms
- CD222 antibody, CIMPR antibody, M6P-R antibody, MPR1 antibody, MPRI antibody, CD-MPR antibody, MPR 46 antibody, MPR-46 antibody, MPR46 antibody, SMPR antibody, Mpr46 antibody, CDMPR antibody, m6pr antibody, MGC68896 antibody, MGC130765 antibody, zgc:77757 antibody, wu:fj81h11 antibody, MGC89423 antibody, M6PR antibody, mprd antibody, C16orf27 antibody, GNPTAG antibody, LP2537 antibody, RJD9 antibody, insulin like growth factor 2 receptor antibody, mannose-6-phosphate receptor, cation dependent antibody, mannose-6-phosphate receptor (cation dependent) L homeolog antibody, mannose-6-phosphate receptor (cation dependent) antibody, mannose-6-phosphate receptor (cation dependent) S homeolog antibody, Cation-dependent mannose-6-phosphate receptor antibody, N-acetylglucosamine-1-phosphate transferase gamma subunit antibody, IGF2R antibody, M6PR antibody, M6pr antibody, m6pr.L antibody, m6pr antibody, m6pr.S antibody, Ethha_1678 antibody, mprd antibody, GNPTG antibody
- Background
- M6PR is a receptor for mannose-6-phosphate groups on lysosomal enzymes. The receptor forms a homodimer or homotetramer for intracellular targeting of lysosomal enzymes and export of newly synthesized lysosomal enzymes into the cell secretions. The receptor is an integral membrane protein which localizes to the trans-Golgi reticulum, endosomes, and the plasma membrane.
- Molecular Weight
- 28 kDa (MW of target protein)
-