H2AFX antibody (N-Term)
-
- Target See all H2AFX Antibodies
- H2AFX (H2A Histone Family, Member X (H2AFX))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This H2AFX antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- H2 AFX antibody was raised against the N terminal of H2 FX
- Purification
- Affinity purified
- Immunogen
- H2 AFX antibody was raised using the N terminal of H2 FX corresponding to a region with amino acids SGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVY
- Top Product
- Discover our top product H2AFX Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
H2AFX Blocking Peptide, catalog no. 33R-8485, is also available for use as a blocking control in assays to test for specificity of this H2AFX antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of H0 FX antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- H2AFX (H2A Histone Family, Member X (H2AFX))
- Alternative Name
- H2AFX (H2AFX Products)
- Synonyms
- H2A.X antibody, H2A/X antibody, H2AX antibody, AW228881 antibody, H2ax antibody, Hist5-2ax antibody, gammaH2ax antibody, zgc:56329 antibody, h2a.x antibody, h2a/x antibody, h2ax antibody, RGD1566119 antibody, h2a antibody, h2afx antibody, H2A histone family member X antibody, H2A histone family, member X antibody, H2A histone family member X L homeolog antibody, histone cluster 1, H2ah antibody, histone cluster 2, H2ab S homeolog antibody, histone H2AX antibody, H2AFX antibody, H2afx antibody, h2afx antibody, h2afx.L antibody, HIST1H2AH antibody, hist2h2ab.S antibody, LOC100522201 antibody, LOC100720536 antibody
- Background
- Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. H2AFX is a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif.
- Molecular Weight
- 16 kDa (MW of target protein)
- Pathways
- Telomere Maintenance, DNA Damage Repair, Positive Regulation of Response to DNA Damage Stimulus
-