LCK antibody (N-Term)

Catalog No. ABIN631231

Product Details anti-LCK Antibody

Target: LCK (Lymphocyte-Specific Protein tyrosine Kinase (LCK))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LCK antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LCK antibody was raised against the N terminal of LCK

Purification: Affinity purified

Immunogen: LCK antibody was raised using the N terminal of LCK corresponding to a region with amino acids PSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LCK Blocking Peptide, catalog no. 33R-7352, is also available for use as a blocking control in assays to test for specificity of this LCK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LCK

Target: LCK (Lymphocyte-Specific Protein tyrosine Kinase (LCK))

Alternative Name: LCK (LCK Products)

Synonyms: zgc:136695 antibody, LCK antibody, Hck-3 antibody, Lsk antibody, Lskt antibody, p56 antibody, p56Lck antibody, LSK antibody, YT16 antibody, p56lck antibody, pp58lck antibody, P56LCK antibody, tkl antibody, Lck1 antibody, Lcktkr antibody, LCK proto-oncogene, Src family tyrosine kinase antibody, lymphocyte protein tyrosine kinase antibody, lck antibody, LCK antibody, Lck antibody

Background: LCK is a member of the Src family of protein tyrosine kinases (PTKs). It is a key signaling molecule in the selection and maturation of developing T-cells. It contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. LCK localizes to the plasma membrane and pericentrosomal vesicles, and binds to cell surface receptors, including CD4 and CD8, and other signaling molecules.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: TCR Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Transition Metal Ion Homeostasis, Positive Regulation of Endopeptidase Activity, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling