Serotonin Receptor 2B antibody
-
- Target See all Serotonin Receptor 2B (HTR2B) Antibodies
- Serotonin Receptor 2B (HTR2B)
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Serotonin Receptor 2B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Serotonin receptor 2 B antibody was raised using a synthetic peptide corresponding to a region with amino acids QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK
- Top Product
- Discover our top product HTR2B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Serotonin receptor 2B Blocking Peptide, catalog no. 33R-7748, is also available for use as a blocking control in assays to test for specificity of this Serotonin receptor 2B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HTR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Serotonin Receptor 2B (HTR2B)
- Alternative Name
- Serotonin Receptor 2B (HTR2B Products)
- Synonyms
- 5-HT2B antibody, 5HT2B antibody, 5htr2b antibody, HTR2B antibody, 5ht2b antibody, zgc:194094 antibody, zgc:194119 antibody, AJ012488 antibody, AV377389 antibody, 5-HT(2B) antibody, 5-hydroxytryptamine receptor 2B antibody, 5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled antibody, 5-hydroxytryptamine (serotonin) receptor 2B antibody, HTR2B antibody, htr2b antibody, Htr2b antibody
- Background
- Multiple receptor subtypes of serotonin neurotransmitters with multiple physiologic functions have been recognised. The 5-HT-2 receptors mediate many of the central and peripheral physiologic functions of serotonin. Cardiovascular effects include contraction of blood vessels and shape changes in platelets, central nervous system effects include neuronal sensitization to tactile stimuli and mediation of hallucinogenic effects of phenylisopropylamine hallucinogens.
- Molecular Weight
- 54 kDa (MW of target protein)
- Pathways
- JAK-STAT Signaling, Inositol Metabolic Process, Regulation of G-Protein Coupled Receptor Protein Signaling, Regulation of Carbohydrate Metabolic Process
-