PPP3CA antibody
-
- Target See all PPP3CA Antibodies
- PPP3CA (Protein Phosphatase 3, Catalytic Subunit, alpha Isoform (PPP3CA))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPP3CA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PPP3 CA antibody was raised using a synthetic peptide corresponding to a region with amino acids LPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINE
- Top Product
- Discover our top product PPP3CA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPP3CA Blocking Peptide, catalog no. 33R-5289, is also available for use as a blocking control in assays to test for specificity of this PPP3CA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 A antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPP3CA (Protein Phosphatase 3, Catalytic Subunit, alpha Isoform (PPP3CA))
- Alternative Name
- PPP3CA (PPP3CA Products)
- Synonyms
- CALN antibody, CALNA antibody, CALNA1 antibody, CCN1 antibody, CNA1 antibody, PPP2B antibody, 2900074D19Rik antibody, AI841391 antibody, AW413465 antibody, CN antibody, Caln antibody, Calna antibody, CnA antibody, Calna1 antibody, calcineurin antibody, caln antibody, calna antibody, calna1 antibody, ccn1 antibody, cna1 antibody, ppp2b antibody, fj46e08 antibody, si:dkeyp-79c2.2 antibody, wu:fj46e08 antibody, ppp3ca antibody, protein phosphatase 3 catalytic subunit alpha antibody, protein phosphatase 3, catalytic subunit, alpha isoform antibody, protein phosphatase 3, catalytic subunit, alpha isozyme antibody, protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform (calcineurin A alpha) antibody, protein phosphatase 3, catalytic subunit, alpha isozyme L homeolog antibody, serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform antibody, PPP3CA antibody, Ppp3ca antibody, ppp3ca antibody, ppp3ca.L antibody, LOC100205420 antibody
- Background
- PPP3CA belongs to the PPP phosphatase family, PP-2B subfamily. It is a calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin. PPP3CA dephosphorylates HSPB1 and SSH1.
- Molecular Weight
- 59 kDa (MW of target protein)
- Pathways
- RTK Signaling, WNT Signaling, Fc-epsilon Receptor Signaling Pathway, Negative Regulation of Hormone Secretion, Carbohydrate Homeostasis, Synaptic Membrane, Skeletal Muscle Fiber Development, Protein targeting to Nucleus, VEGF Signaling, BCR Signaling
-