NDFIP2 antibody (Middle Region)
-
- Target See all NDFIP2 Antibodies
- NDFIP2 (Nedd4 Family Interacting Protein 2 (NDFIP2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NDFIP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NDFIP2 antibody was raised against the middle region of NDFIP2
- Purification
- Affinity purified
- Immunogen
- NDFIP2 antibody was raised using the middle region of NDFIP2 corresponding to a region with amino acids SFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFL
- Top Product
- Discover our top product NDFIP2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NDFIP2 Blocking Peptide, catalog no. 33R-8419, is also available for use as a blocking control in assays to test for specificity of this NDFIP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDFIP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NDFIP2 (Nedd4 Family Interacting Protein 2 (NDFIP2))
- Alternative Name
- NDFIP2 (NDFIP2 Products)
- Synonyms
- MGC68708 antibody, DKFZp459H0627 antibody, N4WBP5A antibody, 0710001O20Rik antibody, 2810436B12Rik antibody, 9130207N19Rik antibody, N4wbp5a antibody, mKIAA1165 antibody, Nedd4 family interacting protein 2 S homeolog antibody, Nedd4 family interacting protein 2 antibody, ndfip2.S antibody, NDFIP2 antibody, ndfip2 antibody, Ndfip2 antibody
- Background
- NDFIP2 activates HECT domain-containing E3 ubiquitin-protein ligases, including ITCH, NEDD4, NEDD4L, SMURF2, WWP1 and WWP2, and consequently modulates the stability of their targets. As a result, NDFIP2 may control many cellular processes. NDFIP2 recruits ITCH, NEDD4 and SMURF2 to endosomal membranes. NDFIP2 may modulate EGFR signaling.
- Molecular Weight
- 36 kDa (MW of target protein)
- Pathways
- Negative Regulation of Transporter Activity, SARS-CoV-2 Protein Interactome
-