RNMT antibody
-
- Target See all RNMT Antibodies
- RNMT (RNA Guanine-7 Methyltransferase (RNMT))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RNMT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RNMT antibody was raised using a synthetic peptide corresponding to a region with amino acids ETEDVPKDKSSTGDGTQNKRKIALEDVPEKQKNLEEGHSSTVAAHYNELQ
- Top Product
- Discover our top product RNMT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RNMT Blocking Peptide, catalog no. 33R-2757, is also available for use as a blocking control in assays to test for specificity of this RNMT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNMT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNMT (RNA Guanine-7 Methyltransferase (RNMT))
- Alternative Name
- RNMT (RNMT Products)
- Synonyms
- xCMT1 antibody, MET antibody, RG7MT1 antibody, hCMT1c antibody, 2610002P10Rik antibody, AI848273 antibody, Rg7mt1 antibody, mKIAA0398 antibody, rnmt antibody, im:6910566 antibody, wu:fi09c12 antibody, RNA (guanine-7-) methyltransferase L homeolog antibody, RNA guanine-7 methyltransferase antibody, RNA (guanine-7-) methyltransferase antibody, rnmt.L antibody, RNMT antibody, Rnmt antibody, rnmt antibody
- Background
- RNMT belongs to the mRNA cap methyltransferase family. RNMT is a mRNA-capping methyltransferase that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs. It binds RNA containing 5'-terminal GpppC.
- Molecular Weight
- 55 kDa (MW of target protein)
-