KCND2 antibody (Middle Region)
-
- Target See all KCND2 Antibodies
- KCND2 (Potassium Voltage-Gated Channel, Shal-Related Subfamily, Member 2 (KCND2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCND2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCND2 antibody was raised against the middle region of KCND2
- Purification
- Affinity purified
- Immunogen
- KCND2 antibody was raised using the middle region of KCND2 corresponding to a region with amino acids RIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHL
- Top Product
- Discover our top product KCND2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCND2 Blocking Peptide, catalog no. 33R-7976, is also available for use as a blocking control in assays to test for specificity of this KCND2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCND2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCND2 (Potassium Voltage-Gated Channel, Shal-Related Subfamily, Member 2 (KCND2))
- Alternative Name
- KCND2 (KCND2 Products)
- Synonyms
- KCND2 antibody, si:dkey-24j9.3 antibody, si:dkeyp-97c5.3 antibody, DKFZp459P1550 antibody, AI839615 antibody, AW555701 antibody, Kv4.2 antibody, R75121 antibody, mKIAA1044 antibody, KV4.2 antibody, RK5 antibody, Shal1 antibody, potassium voltage-gated channel subfamily D member 2 antibody, potassium voltage-gated channel, Shal-related subfamily, member 2 antibody, potassium voltage-gated channel, Shal-related family, member 2 antibody, KCND2 antibody, kcnd2 antibody, Kcnd2 antibody, LOC101669961 antibody
- Background
- Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). KCND2 is a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential.
- Molecular Weight
- 70 kDa (MW of target protein)
-