GRIN2B antibody (Middle Region)

Catalog No. ABIN633768

Product Details anti-GRIN2B Antibody

Target: GRIN2B (Glutamate Receptor, Ionotropic, N-Methyl D-Aspartate 2B (GRIN2B))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GRIN2B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GRIN2 B antibody was raised against the middle region of GRIN2

Purification: Affinity purified

Immunogen: GRIN2 B antibody was raised using the middle region of GRIN2 corresponding to a region with amino acids RSPDHKRYFRDKEGLRDFYLDQFRTKENSPHWEHVDLTDIYKERSDDFKR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GRIN2B Blocking Peptide, catalog no. 33R-8201, is also available for use as a blocking control in assays to test for specificity of this GRIN2B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRIN0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GRIN2B

Target: GRIN2B (Glutamate Receptor, Ionotropic, N-Methyl D-Aspartate 2B (GRIN2B))

Alternative Name: GRIN2B (GRIN2B Products)

Synonyms: NMDAR2B antibody, GluN2B antibody, MRD6 antibody, NR2B antibody, hNR3 antibody, nmdar2b antibody, nr2b antibody, AW490526 antibody, Nmdar2b antibody, glutamate ionotropic receptor NMDA type subunit 2B antibody, glutamate receptor, ionotropic, N-methyl D-aspartate 2B L homeolog antibody, glutamate receptor, ionotropic, NMDA2B (epsilon 2) antibody, GRIN2B antibody, Grin2b antibody, grin2b.L antibody

Background: N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate receptors. NMDA receptor channel has been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning.

Molecular Weight: 163 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus, Synaptic Membrane, Feeding Behaviour, Regulation of long-term Neuronal Synaptic Plasticity