GRIN2B antibody (Middle Region)
-
- Target See all GRIN2B Antibodies
- GRIN2B (Glutamate Receptor, Ionotropic, N-Methyl D-Aspartate 2B (GRIN2B))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GRIN2B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GRIN2 B antibody was raised against the middle region of GRIN2
- Purification
- Affinity purified
- Immunogen
- GRIN2 B antibody was raised using the middle region of GRIN2 corresponding to a region with amino acids RSPDHKRYFRDKEGLRDFYLDQFRTKENSPHWEHVDLTDIYKERSDDFKR
- Top Product
- Discover our top product GRIN2B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GRIN2B Blocking Peptide, catalog no. 33R-8201, is also available for use as a blocking control in assays to test for specificity of this GRIN2B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRIN0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GRIN2B (Glutamate Receptor, Ionotropic, N-Methyl D-Aspartate 2B (GRIN2B))
- Alternative Name
- GRIN2B (GRIN2B Products)
- Synonyms
- NMDAR2B antibody, GluN2B antibody, MRD6 antibody, NR2B antibody, hNR3 antibody, nmdar2b antibody, nr2b antibody, AW490526 antibody, Nmdar2b antibody, glutamate ionotropic receptor NMDA type subunit 2B antibody, glutamate receptor, ionotropic, N-methyl D-aspartate 2B L homeolog antibody, glutamate receptor, ionotropic, NMDA2B (epsilon 2) antibody, GRIN2B antibody, Grin2b antibody, grin2b.L antibody
- Background
- N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate receptors. NMDA receptor channel has been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning.
- Molecular Weight
- 163 kDa (MW of target protein)
- Pathways
- Response to Growth Hormone Stimulus, Synaptic Membrane, Feeding Behaviour, Regulation of long-term Neuronal Synaptic Plasticity
-