PAI1 antibody (N-Term)
-
- Target See all PAI1 (SERPINE1) Antibodies
- PAI1 (SERPINE1) (Plasminogen Activator Inhibitor 1 (SERPINE1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PAI1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SERPINE1 antibody was raised against the N terminal of SERPINE1
- Purification
- Affinity purified
- Immunogen
- SERPINE1 antibody was raised using the N terminal of SERPINE1 corresponding to a region with amino acids VAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQ
- Top Product
- Discover our top product SERPINE1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SERPINE1 Blocking Peptide, catalog no. 33R-9417, is also available for use as a blocking control in assays to test for specificity of this SERPINE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PAI1 (SERPINE1) (Plasminogen Activator Inhibitor 1 (SERPINE1))
- Alternative Name
- SERPINE1 (SERPINE1 Products)
- Synonyms
- PAI antibody, PAI-1 antibody, PAI1 antibody, PLANH1 antibody, SERPINE1 antibody, si:ch211-138a11.1 antibody, Planh1 antibody, PAI1A antibody, Pai1 antibody, Pai1aa antibody, Planh antibody, RATPAI1A antibody, serpin family E member 1 antibody, serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1 L homeolog antibody, serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1 antibody, serine (or cysteine) peptidase inhibitor, clade E, member 1 antibody, SERPINE1 antibody, serpine1.L antibody, serpine1 antibody, Serpine1 antibody
- Background
- SERPINE1 acts as 'bait' for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis.
- Molecular Weight
- 43 kDa (MW of target protein)
- Pathways
- p53 Signaling, Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Autophagy, Smooth Muscle Cell Migration
-