HGF antibody

Catalog No. ABIN634273

Product Details anti-HGF Antibody

Target: HGF (Hepatocyte Growth Factor (Hepapoietin A, Scatter Factor) (HGF))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HGF antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: HGF antibody was raised using a synthetic peptide corresponding to a region with amino acids GESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HGF Blocking Peptide, catalog no. 33R-3251, is also available for use as a blocking control in assays to test for specificity of this HGF antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HGF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HGF

Target: HGF (Hepatocyte Growth Factor (Hepapoietin A, Scatter Factor) (HGF))

Alternative Name: HGF (HGF Products)

Synonyms: DFNB39 antibody, F-TCF antibody, HGFB antibody, HPTA antibody, SF antibody, HGF antibody, C230052L06Rik antibody, HGF/SF antibody, NK1 antibody, NK2 antibody, SF/HGF antibody, hepatocyte growth factor antibody, HGF antibody, Hgf antibody

Background: Hepatocyte growth factor regulates cell growth, cell motility, and morphogenesis by activating a tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. Hepatocyte growth factor is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability to stimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis, and tissue regeneration. It is secreted as a single inactive polypeptide and is cleaved by serine proteases into a 69 kDa alpha-chain and 34 kDa beta-chain. A disulfide bond between the alpha and beta chains produces the active, heterodimeric molecule. The protein belongs to the plasminogen subfamily of S1 peptidases but has no detectable protease activity.

Molecular Weight: 26 kDa (MW of target protein)

Pathways: RTK Signaling, Carbohydrate Homeostasis, Glycosaminoglycan Metabolic Process, Synaptic Membrane, Signaling of Hepatocyte Growth Factor Receptor