TBK1 antibody (N-Term)

Catalog No. ABIN634305

Product Details anti-TBK1 Antibody

Target: TBK1 (TANK-Binding Kinase 1 (TBK1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TBK1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TBK1 antibody was raised against the N terminal of TBK1

Purification: Affinity purified

Immunogen: TBK1 antibody was raised using the N terminal of TBK1 corresponding to a region with amino acids EEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TBK1 Blocking Peptide, catalog no. 33R-2352, is also available for use as a blocking control in assays to test for specificity of this TBK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TBK1

Target: TBK1 (TANK-Binding Kinase 1 (TBK1))

Alternative Name: TBK1 (TBK1 Products)

Synonyms: nak antibody, t2k antibody, TBK1 antibody, wu:fk70c05 antibody, zgc:136548 antibody, NAK antibody, T2K antibody, 1200008B05Rik antibody, AI462036 antibody, AW048562 antibody, TANK binding kinase 1 L homeolog antibody, TANK binding kinase 1 antibody, TANK-binding kinase 1 antibody, tbk1.L antibody, TBK1 antibody, tbk1 antibody, Tbk1 antibody

Background: The NF-kappa-B (NFKB) complex of proteins is inhibited by I-kappa-B (IKB) proteins, which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the IKB proteins by IKB kinases marks them for destruction via the ubiquitination pathway, thereby allowing activation and nuclear translocation of the NFKB complex. TBK1 is similar to IKB kinases and can mediate NFKB activation in response to certain growth factors. For example, the protein can form a complex with the IKB protein TANK and TRAF2 and release the NFKB inhibition caused by TANK.

Molecular Weight: 84 kDa (MW of target protein)

Pathways: TLR Signaling, Activation of Innate immune Response, Hepatitis C, Toll-Like Receptors Cascades, SARS-CoV-2 Protein Interactome