Selenoprotein S antibody (Middle Region)
-
- Target See all Selenoprotein S (SELS) Antibodies
- Selenoprotein S (SELS)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Selenoprotein S antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SELS antibody was raised against the middle region of SELS
- Purification
- Affinity purified
- Immunogen
- SELS antibody was raised using the middle region of SELS corresponding to a region with amino acids PDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDS
- Top Product
- Discover our top product SELS Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SELS Blocking Peptide, catalog no. 33R-7030, is also available for use as a blocking control in assays to test for specificity of this SELS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SELS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Selenoprotein S (SELS)
- Alternative Name
- SELS (SELS Products)
- Synonyms
- ADO15 antibody, SBBI8 antibody, SELS antibody, SEPS1 antibody, 1500011E07Rik antibody, C78786 antibody, H-4 antibody, H-47 antibody, H4 antibody, H47 antibody, Sels antibody, sg2 antibody, selenoprotein S antibody, SELENOS antibody, Selenos antibody
- Background
- SELS is a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Studies suggest that this protein may regulate cytokine production, and thus play a key role in the control of the inflammatory response.
- Molecular Weight
- 21 kDa (MW of target protein)
- Pathways
- Cellular Response to Molecule of Bacterial Origin, ER-Nucleus Signaling, Regulation of Carbohydrate Metabolic Process, Cell RedoxHomeostasis, Negative Regulation of intrinsic apoptotic Signaling, SARS-CoV-2 Protein Interactome
-