TNFSF18 antibody

Catalog No. ABIN634583

Product Details anti-TNFSF18 Antibody

Target: TNFSF18 (Tumor Necrosis Factor (Ligand) Superfamily, Member 18 (TNFSF18))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TNFSF18 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: TNFSF18 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TNFSF18 Blocking Peptide, catalog no. 33R-4504, is also available for use as a blocking control in assays to test for specificity of this TNFSF18 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNFSF18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TNFSF18

Target: TNFSF18 (Tumor Necrosis Factor (Ligand) Superfamily, Member 18 (TNFSF18))

Alternative Name: TNFSF18 (TNFSF18 Products)

Synonyms: Gitrl antibody, AITRL antibody, GITRL antibody, TL6 antibody, hGITRL antibody, TNLG2A antibody, tumor necrosis factor (ligand) superfamily, member 18 antibody, TNF superfamily member 18 antibody, Tnfsf18 antibody, TNFSF18 antibody

Background: TNFSF18 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells.

Molecular Weight: 23 kDa (MW of target protein)