CDH23 antibody (Middle Region)
-
- Target See all CDH23 Antibodies
- CDH23 (Cadherin 23 (CDH23))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CDH23 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CDH23 antibody was raised against the middle region of CDH23
- Purification
- Affinity purified
- Immunogen
- CDH23 antibody was raised using the middle region of CDH23 corresponding to a region with amino acids DYISGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNI
- Top Product
- Discover our top product CDH23 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CDH23 Blocking Peptide, catalog no. 33R-2240, is also available for use as a blocking control in assays to test for specificity of this CDH23 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH23 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CDH23 (Cadherin 23 (CDH23))
- Alternative Name
- CDH23 (CDH23 Products)
- Synonyms
- 4930542A03Rik antibody, USH1D antibody, ahl antibody, ahl1 antibody, bob antibody, bus antibody, mdfw antibody, nmf112 antibody, nmf181 antibody, nmf252 antibody, sals antibody, v antibody, CDHR23 antibody, W antibody, cadherin 23 (otocadherin) antibody, cadherin related 23 antibody, cadherin-related 23 antibody, Cdh23 antibody, CDH23 antibody
- Background
- This gene is a member of the cadherin superfamily, whose genes encode calcium dependent cell-cell adhesion glycoproteins. The encoded protein is thought to be involved in stereocilia organization and hair bundle formation.
- Molecular Weight
- 56 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-