KREMEN1 antibody (N-Term)
-
- Target See all KREMEN1 Antibodies
- KREMEN1 (Kringle Containing Transmembrane Protein 1 (KREMEN1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KREMEN1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KREMEN1 antibody was raised against the N terminal of KREMEN1
- Purification
- Affinity purified
- Immunogen
- KREMEN1 antibody was raised using the N terminal of KREMEN1 corresponding to a region with amino acids LKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPG
- Top Product
- Discover our top product KREMEN1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KREMEN1 Blocking Peptide, catalog no. 33R-5114, is also available for use as a blocking control in assays to test for specificity of this KREMEN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KREMEN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KREMEN1 (Kringle Containing Transmembrane Protein 1 (KREMEN1))
- Alternative Name
- KREMEN1 (KREMEN1 Products)
- Synonyms
- KREMEN1 antibody, krm1 antibody, kremen antibody, kremem1 antibody, KREMEN antibody, KRM1 antibody, AV002070 antibody, Kremen antibody, Krm1 antibody, si:ct737139.1 antibody, si:dkeyp-7c9.1 antibody, kringle containing transmembrane protein 1 antibody, kringle containing transmembrane protein 1 S homeolog antibody, KREMEN1 antibody, kremen1 antibody, Kremen1 antibody, kremen1.S antibody
- Background
- KREMEN1 is a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. It is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains.
- Molecular Weight
- 50 kDa (MW of target protein)
- Pathways
- WNT Signaling
-