SIGIRR antibody
-
- Target See all SIGIRR Antibodies
- SIGIRR (Single Immunoglobulin and Toll-Interleukin 1 Receptor (TIR) Domain (SIGIRR))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SIGIRR antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SIGIRR antibody was raised using a synthetic peptide corresponding to a region with amino acids PVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYSARTDFYCLVSKDDM
- Top Product
- Discover our top product SIGIRR Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SIGIRR Blocking Peptide, catalog no. 33R-7406, is also available for use as a blocking control in assays to test for specificity of this SIGIRR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGIRR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SIGIRR (Single Immunoglobulin and Toll-Interleukin 1 Receptor (TIR) Domain (SIGIRR))
- Alternative Name
- SIGIRR (SIGIRR Products)
- Synonyms
- TIR8 antibody, AI256711 antibody, sc:d148 antibody, RGD1306732 antibody, single Ig and TIR domain containing antibody, single immunoglobulin and toll-interleukin 1 receptor (TIR) domain antibody, SIGIRR antibody, Sigirr antibody, sigirr antibody
- Background
- SIGIRR acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. It attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through a TIR-TIR domain interaction with TLR4. Through its extracellular domain it interferes with the heterodimerization of Il1R1 and IL1RAP.
- Molecular Weight
- 25 kDa (MW of target protein)
- Pathways
- Toll-Like Receptors Cascades
-