LRP8 antibody (Middle Region)

Catalog No. ABIN635949

Product Details anti-LRP8 Antibody

Target: LRP8 (Low Density Lipoprotein Receptor-Related Protein 8, Apolipoprotein E Receptor (LRP8))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRP8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LRP8 antibody was raised against the middle region of LRP8

Purification: Affinity purified

Immunogen: LRP8 antibody was raised using the middle region of LRP8 corresponding to a region with amino acids ATVDGGRRRTLFSRNLSEPRAIAVDPLRGFMYWSDWGDQAKIEKSGLNGV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRP8 Blocking Peptide, catalog no. 33R-1575, is also available for use as a blocking control in assays to test for specificity of this LRP8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRP8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRP8

Target: LRP8 (Low Density Lipoprotein Receptor-Related Protein 8, Apolipoprotein E Receptor (LRP8))

Alternative Name: LRP8 (LRP8 Products)

Synonyms: LRP8 antibody, APOER2 antibody, HSZ75190 antibody, LRP-8 antibody, MCI1 antibody, 4932703M08Rik antibody, AA921429 antibody, AI848122 antibody, ApoER2 antibody, Lr8b antibody, LR8B antibody, LDL receptor related protein 8 antibody, low density lipoprotein receptor-related protein 8, apolipoprotein e receptor antibody, LRP8 antibody, Lrp8 antibody

Background: LRP8 is an apolipoprotein E receptor, a member of the low density lipoprotein receptor (LDLR) family. Apolipoprotein E is a small lipophilic plasma protein and a component of lipoproteins such as chylomicron remnants, very low density lipoprotein (VLDL), and high density lipoprotein (HDL).

Molecular Weight: 74 kDa (MW of target protein)