HSD11B1 antibody

Catalog No. ABIN636041

Product Details anti-HSD11B1 Antibody

Target: HSD11B1 (Hydroxysteroid (11-Beta) Dehydrogenase 1 (HSD11B1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSD11B1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: HSD11 B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSD11B1 Blocking Peptide, catalog no. 33R-7614, is also available for use as a blocking control in assays to test for specificity of this HSD11B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HSD11B1

Target: HSD11B1 (Hydroxysteroid (11-Beta) Dehydrogenase 1 (HSD11B1))

Alternative Name: HSD11B1 (HSD11B1 Products)

Synonyms: 11-DH antibody, 11-beta-HSD1 antibody, CORTRD2 antibody, HDL antibody, HSD11 antibody, HSD11B antibody, HSD11L antibody, SDR26C1 antibody, hsd11 antibody, hsd11b antibody, LRRGT00065 antibody, hydroxysteroid 11-beta dehydrogenase 1 antibody, hydroxysteroid (11-beta) dehydrogenase 1b antibody, hydroxysteroid (11-beta) dehydrogenase 1 L homeolog antibody, HSD11B1 antibody, HSD11B1b antibody, hsd11b1.L antibody, Hsd11b1 antibody

Background: HSD11B1 is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, HSD11B1 can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children.

Molecular Weight: 32 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis, Regulation of Carbohydrate Metabolic Process