HAS1 antibody
-
- Target See all HAS1 Antibodies
- HAS1 (Hyaluronan Synthase 1 (HAS1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HAS1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Hyaluronan synthase 1/HAS1 detection. Tested with WB, IHC-P, ICC/IF in Human,Mouse,Rat.
- Sequence
- NRAEDLYMVD MFREVFADED PATYVWDGNY HQPWEPA
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
- Rabbit IgG polyclonal antibody for Hyaluronan synthase 1/HAS1 detection. Tested with WB, IHC-P, ICC/IF in Human,Mouse,Rat.
- Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence of human Hyaluronan synthase 1/HAS1(NRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPA)
- Isotype
- IgG
- Top Product
- Discover our top product HAS1 Primary Antibody
-
-
- Application Notes
-
Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL Immunocytochemistry/Immunofluorescence|2 μg/mL
- Comment
-
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- HAS1 (Hyaluronan Synthase 1 (HAS1))
- Alternative Name
- HAS1 (HAS1 Products)
- Synonyms
- dg42 antibody, Xhas1 antibody, HAS antibody, shas1 antibody, hyaluronan synthase 1 antibody, hyaluronan synthase 1 S homeolog antibody, has1 antibody, HAS1 antibody, Has1 antibody, has1.S antibody
- Background
-
Synonyms: Hyaluronan synthase 1, Hyaluronate synthase 1, Hyaluronic acid synthase 1, HA synthase 1, HuHAS1, HAS1, HAS
Background: Hyaluronan synthase 1 is an enzyme that in humans is encoded by the HAS1 gene. This gene is mapped to 19q13.41. Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide variety of organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternating glucuronic acid and N-acetylglucosamine residues that are linked by beta-1-3 and beta-1-4 glycosidic bonds. It serves a variety of functions, including space filling, lubrication of joints, and provision of a matrix through which cells can migrate. HA is actively produced during wound healing and tissue repair to provide a framework for ingrowth of blood vessels and fibroblasts. AS1 is a member of the newly identified vertebrate gene family encoding putative hyaluronan synthases, and its amino acid sequence shows significant homology to the hasA gene product of Streptococcus pyogenes, a glycosaminoglycan synthetase (DG42) from Xenopus laevis, and a recently described murine hyaluronan synthase.
- Gene ID
- 3036
- UniProt
- Q92839
- Pathways
- Glycosaminoglycan Metabolic Process
-