HAS1 antibody

Catalog No. ABIN6719425

Product Details anti-HAS1 Antibody

Target: HAS1 (Hyaluronan Synthase 1 (HAS1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HAS1 antibody is un-conjugated

Application: Western Blotting (WB), Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Hyaluronan synthase 1/HAS1 detection. Tested with WB, IHC-P, ICC/IF in Human,Mouse,Rat.

Sequence: NRAEDLYMVD MFREVFADED PATYVWDGNY HQPWEPA

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Hyaluronan synthase 1/HAS1 detection. Tested with WB, IHC-P, ICC/IF in Human,Mouse,Rat.

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human Hyaluronan synthase 1/HAS1(NRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPA)

Isotype: IgG

Application Details

Application Notes:

Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL Immunocytochemistry/Immunofluorescence|2 μg/mL

Comment:

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for HAS1

Target: HAS1 (Hyaluronan Synthase 1 (HAS1))

Alternative Name: HAS1 (HAS1 Products)

Synonyms: dg42 antibody, Xhas1 antibody, HAS antibody, shas1 antibody, hyaluronan synthase 1 antibody, hyaluronan synthase 1 S homeolog antibody, has1 antibody, HAS1 antibody, Has1 antibody, has1.S antibody

Background:

Synonyms: Hyaluronan synthase 1, Hyaluronate synthase 1, Hyaluronic acid synthase 1, HA synthase 1, HuHAS1, HAS1, HAS

Background: Hyaluronan synthase 1 is an enzyme that in humans is encoded by the HAS1 gene. This gene is mapped to 19q13.41. Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide variety of organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternating glucuronic acid and N-acetylglucosamine residues that are linked by beta-1-3 and beta-1-4 glycosidic bonds. It serves a variety of functions, including space filling, lubrication of joints, and provision of a matrix through which cells can migrate. HA is actively produced during wound healing and tissue repair to provide a framework for ingrowth of blood vessels and fibroblasts. AS1 is a member of the newly identified vertebrate gene family encoding putative hyaluronan synthases, and its amino acid sequence shows significant homology to the hasA gene product of Streptococcus pyogenes, a glycosaminoglycan synthetase (DG42) from Xenopus laevis, and a recently described murine hyaluronan synthase.

Gene ID: 3036

UniProt: Q92839

Pathways: Glycosaminoglycan Metabolic Process