anti-Human Amyloid beta (A4) Precursor-Like Protein 2 antibody for Immunocytochemistry

Recommended Amyloid beta (A4) Precursor-Like Protein 2 Antibody (supplied by: Log in to see )

Antigen
Amyloid beta (A4) Precursor-Like Protein 2 (APLP2) Antibodies
  • APLP-2
  • APPH
  • APPL2
  • CDEBP
  • AI790698
  • Apph
  • WALPLP2
  • aplp2 B
  • APLP2
  • si:dkey-11k4.3
  • aplp2 A
  • MGC86389
  • amyloid beta precursor like protein 2
  • amyloid beta (A4) precursor-like protein 2
  • amyloid beta (A4) precursor-like protein 2 S homeolog
  • amyloid beta (A4) precursor-like protein 2 L homeolog
  • APLP2
  • Aplp2
  • aplp2.S
  • aplp2
  • aplp2.L
Reactivity
Human
111
67
53
2
Host
Rabbit
101
10
Clonality
Polyclonal
Conjugate
Un-conjugated
5
4
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
79
56
55
16
13
7
4
3
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4281104
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1866716 ICC IHC WB Rabbit IgG AA 1-210 Log in to see Polyclonal 0

General

Antigen Amyloid beta (A4) Precursor-Like Protein 2 (APLP2) Antibodies
Reactivity Human
(111), (67), (53), (2)
Host Rabbit
(101), (10)
Clonality
Polyclonal
Conjugate Un-conjugated
(5), (4), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(79), (56), (55), (16), (13), (7), (4), (3), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product details

Target Details Application Details Handling References Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PYVAQEIQEEIDELLQEQRADMDQFTASISETPVDVRVSSEESEEIPPFHPFHPFPALPENEDTQPELYHPMK
Isotype IgG

Target Details

Product details Application Details Handling References Images back to top
Antigen
Alternative Name APLP-2 (APLP2 Antibody Abstract)
Background Gene Symbol: APLP2
Molecular Weight Theoretical MW: 87 kDa
Gene ID 334
UniProt Q06481
Pathways EGFR Signaling Pathway, Transition Metal Ion Homeostasis, Feeding Behaviour

Application Details

Product details Target Details Handling References Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product details Target Details Application Details References Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References

Product details Target Details Application Details Handling Images back to top
Product cited in:

Jackson, Du, Janesko-Feldman, Vagni, Dezfulian, Poloyac, Jackson, Clark, Kochanek: "The nuclear splicing factor RNA binding motif 5 promotes caspase activation in human neuronal cells, and increases after traumatic brain injury in mice." in: Journal of cerebral blood flow and metabolism : official journal of the International Society of Cerebral Blood Flow and Metabolism, Vol. 35, Issue 4, pp. 655-66, 2015 (Sample species: Mouse (Murine)). Further details: Western Blotting

Images

Product details Target Details Application Details Handling References back to top
Supplier Images
Immunofluorescence (IF) image for anti-Amyloid beta (A4) Precursor-Like Protein 2 (APLP2) antibody (ABIN4281104) Immunocytochemistry/Immunofluorescence: APLP2 Antibody [NBP1-89029] - Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Amyloid beta (A4) Precursor-Like Protein 2 (APLP2) antibody (ABIN4281104) Immunohistochemistry-Paraffin: APLP2 Antibody [NBP1-89029] - Staining of human kidney...
Immunofluorescence (IF) image for anti-Amyloid beta (A4) Precursor-Like Protein 2 (APLP2) antibody (ABIN4281104) Immunocytochemistry/Immunofluorescence: APLP-2 Antibody - Immunofluorescent staining...