anti-Human LARS antibody for Immunohistochemistry

Recommended LARS Antibody (supplied by: Log in to see )

Antigen
Leucyl-tRNA Synthetase (LARS) Antibodies
  • HSPC192
  • LARS1
  • LEURS
  • LEUS
  • LRS
  • PIG44
  • RNTLS
  • hr025Cl
  • CG7479
  • Dmel\\CG7479
  • LeuRS
  • F21M12.1
  • F21M12_1
  • BA4991
  • DDBDRAFT_0183834
  • DDBDRAFT_0231251
  • DDB_0183834
  • DDB_0231251
  • 2310045K21Rik
  • 3110009L02Rik
  • AW536573
  • mKIAA1352
  • leucyl-tRNA synthetase
  • Leucyl-tRNA synthetase, mitochondrial
  • ATP binding/leucine-tRNA ligases/aminoacyl-tRNA ligase
  • leucine--tRNA ligase
  • leucyl-tRNA synthetase LeuS
  • leucyl-tRNA ligase
  • leucine-tRNA ligase
  • LARS
  • LeuRS-m
  • AT1G09620
  • leuS
  • APH_RS02290
  • mleuS
  • Lars
Reactivity
Human
24
15
6
2
1
1
1
1
1
1
Host
Rabbit
27
Clonality
Polyclonal
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
26
12
7
5
5
4
3
3
2
2
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4330335
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN4330336 ICC IF IHC IHC (p) Rabbit IgG Log in to see Polyclonal 0
1 ABIN4330338 IHC WB Rabbit Log in to see Polyclonal 0
1 ABIN2297313 IHC ELISA WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN5013873 ICC IHC WB Rabbit IgG AA 260-509 Log in to see Polyclonal 0
1 ABIN1805074 IHC IHC (p) WB Rabbit AA 1118-1145 Log in to see Polyclonal 0
1 ABIN5582390 IHC WB Rabbit Log in to see Polyclonal 0
1 ABIN6001124 IF/ICC IHC IP WB Rabbit AA 260-509 Log in to see Polyclonal 0
1 ABIN5698061 ELISA IF IHC IP WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2937398 ELISA IF/ICC IHC WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1088111 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2145584 IF IHC ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN5870407 ELISA IF/ICC IHC IP WB Rabbit IgG Log in to see Polyclonal 0

General

Antigen Leucyl-tRNA Synthetase (LARS) Antibodies
Reactivity Human
(24), (15), (6), (2), (1), (1), (1), (1), (1), (1)
Host Rabbit
(27)
Clonality
Polyclonal
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(26), (12), (7), (5), (5), (4), (3), (3), (2), (2)
Supplier Log in to see

Product Details anti-LARS Antibody

Target Details LARS Application Details Handling Images
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KWDTERVFEVNASNLEKQTSKGKYFVTFPYPYMNGRLHLGHTFSLSKCEFAVGYQRLKGKCCLFPFGLHCTGMPIKACADKLK
Plasmids, Primers & others

Target Details LARS

Product Details anti-LARS Antibody Application Details Handling Images back to top
Antigen
Alternative Name LARS (LARS Antibody Abstract)
Background Gene Symbol: LARS
Gene ID 51520
UniProt Q9P2J5
Pathways EGFR Signaling Pathway

Application Details

Product Details anti-LARS Antibody Target Details LARS Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-LARS Antibody Target Details LARS Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-LARS Antibody Target Details LARS Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Leucyl-tRNA Synthetase (LARS) antibody (ABIN4330335) Western Blot: LARS Antibody [NBP2-38478] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunohistochemistry (IHC) image for anti-Leucyl-tRNA Synthetase (LARS) antibody (ABIN4330335) Immunohistochemistry: LARS Antibody [NBP2-38478] - Staining of human urinary bladder ...
Immunofluorescence (IF) image for anti-Leucyl-tRNA Synthetase (LARS) antibody (ABIN4330335) Immunocytochemistry/Immunofluorescence: LARS Antibody [NBP2-38478] - Immunofluorescen...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Leucyl-tRNA Synthetase (LARS) antibody (ABIN4330335) Immunohistochemistry-Paraffin: LARS Antibody - Staining of human urinary bladder sho...