anti-Mouse (Murine) Leptin antibody for ELISA

Recommended Leptin Antibody (supplied by: Log in to see )

Leptin (LEP) Antibodies
  • ob
  • obese
  • LEPD
  • OB
  • OBS
  • leptin
  • Lep
  • LEP
  • lep
AA 74-109, Middle Region
Mouse (Murine)
This Leptin antibody is un-conjugated
ELISA, Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN3043294
$ 240.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN465757 IHC (pfa) ELISA WB Rabbit Log in to see Polyclonal 0
1 ABIN214037 IHC (p) ELISA WB Rabbit Log in to see Polyclonal 0
1 ABIN3201294 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG AA 22-167 Log in to see 0
1 ABIN1585862 IHC ELISA WB Rabbit N-Term Log in to see Polyclonal 0
1 ABIN465756 ELISA IHC (pfa) WB Biotin Rabbit Log in to see Polyclonal 0
1 ABIN1169154 IP ELISA WB Biotin Rabbit Log in to see Polyclonal 0
1 ABIN108522 ELISA WB Rabbit Log in to see Polyclonal 6
1 ABIN2469665 IHC ELISA WB Rabbit Log in to see Polyclonal 0
1 ABIN205695 IHC (p) ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2884678 IHC ELISA Rabbit IgG AA 36-85 Log in to see Polyclonal 0
1 ABIN1736401 IHC (p) ELISA WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN108521 ELISA WB Rabbit Log in to see Polyclonal 4
1 ABIN2612674 ELISA WB Biotin Rabbit IgG AA 22-167 Log in to see Polyclonal 0
1 ABIN2612677 ELISA WB FITC Rabbit IgG AA 22-167 Log in to see Polyclonal 0
1 ABIN799626 ELISA WB Rabbit Log in to see Polyclonal 0
1 ABIN1822631 ELISA Rabbit IgG Log in to see Polyclonal 0
1 ABIN2612670 ELISA WB Rabbit IgG AA 22-167 Log in to see Polyclonal 0
1 ABIN2612680 ELISA WB Rat IgG AA 22-167 Log in to see 0
1 ABIN2612690 ELISA WB Rabbit Log in to see Polyclonal 0
1 ABIN2612691 ELISA WB Rabbit Log in to see Polyclonal 0


Antigen Leptin (LEP) Antibodies
Epitope AA 74-109, Middle Region
(33), (24), (18), (15), (15), (15), (11), (6), (6), (6), (6), (6), (6), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivity Mouse (Murine)
(450), (176), (157), (25), (7), (5), (4), (4), (4), (4), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1)
Host Rabbit
(373), (236), (20), (10), (4), (1)
Conjugate This Leptin antibody is un-conjugated
(68), (28), (19), (14), (14), (9), (9), (7), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (5), (4), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2)
Application ELISA, Western Blotting (WB)
(450), (443), (106), (57), (56), (39), (32), (29), (26), (26), (17), (13), (9), (6), (5), (4), (4), (4), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Pubmed 3 references available
Supplier Log in to see

Product Details anti-Leptin Antibody

Target Details Leptin Application Details Handling References for anti-Leptin antibody (ABIN3043294) Images
Purpose Rabbit IgG polyclonal antibody for Leptin(LEP) detection. Tested with WB, ELISA in Mouse.
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Leptin(LEP) detection. Tested with WB, ELISA in Mouse.
Gene Name: leptin
Protein Name: Leptin
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence in the middle region of mouse Leptin (74-109aa KMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLH), different from the related human sequence by five amino acids, and from the related rat sequence by two amino acids.
Isotype IgG

Target Details Leptin

Product Details anti-Leptin Antibody Application Details Handling References for anti-Leptin antibody (ABIN3043294) Images back to top
Alternative Name LEP (LEP Antibody Abstract)
Background Leptin is a protein product of the mouse obese gene. Mice with mutations in the obese gene that block the synthesis of Leptin have been found to be obese and diabetic and to have reduced activity, metabolism and body temperature. cDNA clones encoding Leptin have been isolated from human, simian, mouse, and rat cells. The expression of Leptin mRNA has been shown to be restricted to adipose tissue. Although regulation of fat stores is deemed to be the primary function of leptin, it also plays a role in other physiological processes, as evidenced by its multiple sites of synthesis other than fat cells, and the multiple cell types beside hypothalamic cells that have leptin receptors. Many of these additional functions are yet to be defined.

Synonyms: FLJ94114 antibody|LEP antibody|LEP_HUMAN antibody|LEPD antibody|Leptin (murine obesity homolog) antibody|Leptin (obesity homolog, mouse) antibody|Leptin antibody|Leptin Murine Obesity Homolog antibody|Leptin Precursor Obesity Factor antibody|OB antibody|Obese Protein antibody|Obese, mouse, homolog of antibody|Obesity antibody|Obesity factor antibody|Obesity factor antibody|Obesity homolog mouse antibody|Obesity Murine Homolog Leptin antibody|OBS antibody|OTTHUMP00000212285 antibody
Gene ID 16846
UniProt P41160
Pathways JAK-STAT Signaling, AMPK Signaling, Hormone Transport, Peptide Hormone Metabolism, Hormone Activity, Negative Regulation of Hormone Secretion, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Monocarboxylic Acid Catabolic Process

Application Details

Product Details anti-Leptin Antibody Target Details Leptin Handling References for anti-Leptin antibody (ABIN3043294) Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse

Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions For Research Use only


Product Details anti-Leptin Antibody Target Details Leptin Application Details References for anti-Leptin antibody (ABIN3043294) Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-Leptin antibody (ABIN3043294)

Product Details anti-Leptin Antibody Target Details Leptin Application Details Handling Images back to top
Product cited in:

Qin, Ma, Yang, Hu, Zhou, Fu, Tian, Liu, Xu, Shen: "A Triterpenoid Inhibited Hormone-Induced Adipocyte Differentiation and Alleviated Dexamethasone-Induced Insulin Resistance in 3T3-L1 adipocytes." in: Natural products and bioprospecting, Vol. 5, Issue 3, pp. 159-66, 2015

Yuan, Zhang, Cai, Ding, Wang, Chen, Wang, Yan, Lu: "Leptin induces cell proliferation and reduces cell apoptosis by activating c-myc in cervical cancer." in: Oncology reports, Vol. 29, Issue 6, pp. 2291-6, 2013

Cheng, Dai, Dai: "Testis dysfunction by isoproterenol is mediated by upregulating endothelin receptor A, leptin and protein kinase Cvarepsilon and is attenuated by an endothelin receptor antagonist CPU0213." in: Reproductive toxicology (Elmsford, N.Y.), Vol. 29, Issue 4, pp. 421-6, 2010


Product Details anti-Leptin Antibody Target Details Leptin Application Details Handling References for anti-Leptin antibody (ABIN3043294) back to top
Supplier Images
Western Blotting (WB) image for anti-Leptin (LEP) (AA 74-109), (Middle Region) antibody (ABIN3043294) Observed bind size: 16KD