anti-Human Serotonin Receptor 4 antibody for Immunohistochemistry

Recommended Serotonin Receptor 4 Antibody (supplied by: Log in to see )

Serotonin Receptor 4 (HTR4) Antibodies
  • 5-HT4
  • 5-HT<4L>
  • 5HTR4
  • 5-HT4S
  • 5-HT4R
  • 5 hydroxytryptamine (serotonin) receptor 4
  • 5-hydroxytryptamine receptor 4
  • Htr4
  • HTR4
This Serotonin Receptor 4 antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4276893
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1832370 IHC Mouse IgG2b Log in to see 11n173
1 ABIN2193106 IHC Rabbit C-Term Log in to see Polyclonal
1 ABIN2193035 IHC Rabbit Log in to see Polyclonal
1 ABIN2193105 IHC Rabbit Log in to see Polyclonal
1 ABIN572121 IHC WB Rabbit C-Term Log in to see Polyclonal
1 ABIN2358318 IHC ELISA Goat C-Term Log in to see Polyclonal
1 ABIN2193034 IHC Rabbit C-Term Log in to see Polyclonal
1 ABIN2771386 IHC (p) IHC ELISA Goat C-Term Log in to see Polyclonal


Antigen Serotonin Receptor 4 (HTR4) Antibodies
Reactivity Human
(119), (57), (55), (9), (7), (6), (6), (5), (5), (3), (3), (2)
Host Rabbit
(113), (5), (2)
Conjugate This Serotonin Receptor 4 antibody is un-conjugated
(4), (4), (4), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(63), (31), (29), (26), (24), (12), (9), (3), (2), (2), (1)
Supplier Log in to see

Product Details anti-Serotonin Receptor 4 Antibody

Target Details Serotonin Receptor 4 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: FRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQW ESQCHPPATSPLVAAQPSD
Isotype IgG

Target Details Serotonin Receptor 4

Product Details anti-Serotonin Receptor 4 Antibody Application Details Handling Images back to top
Alternative Name 5-HT4 (HTR4 Antibody Abstract)
Background Gene Symbol: HTR4
Gene ID 3360
Pathways JAK-STAT Signaling, cAMP Metabolic Process

Application Details

Product Details anti-Serotonin Receptor 4 Antibody Target Details Serotonin Receptor 4 Handling Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-Serotonin Receptor 4 Antibody Target Details Serotonin Receptor 4 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-Serotonin Receptor 4 Antibody Target Details Serotonin Receptor 4 Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Serotonin Receptor 4 (HTR4) antibody (ABIN4276893) Immunohistochemistry: 5-HT4 Antibody [NBP2-14109] - Staining of human stomach, upper ...