anti-Influenza A Virus IVNS1ABP antibody for Immunohistochemistry

Recommended IVNS1ABP Antibody (supplied by: Log in to see )

Influenza Virus NS1A Binding Protein (IVNS1ABP) Antibodies
  • FLARA3
  • HSPC068
  • KLHL39
  • ND1
  • NS-1
  • NS1-BP
  • NS1BP
  • 1190004M08Rik
  • 1700126I16Rik
  • AA960440
  • Nd1-L
  • Nd1-S
  • mKIAA0850
  • cb1052
  • fj23g11
  • ivns1abp
  • wu:fj23g11
  • influenza virus NS1A binding protein
  • influenza virus NS1A binding protein L homeolog
  • influenza virus NS1A binding protein a
  • Ivns1abp
  • ivns1abp.L
  • ivns1abpa
Influenza A Virus
Immunohistochemistry (IHC), Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Catalog No. ABIN630725
$ 473.93
Plus shipping costs $45.00


Antigen Influenza Virus NS1A Binding Protein (IVNS1ABP) Antibodies
Epitope N-Term
(5), (1), (1), (1)
Reactivity Influenza A Virus
(21), (13), (11), (9), (6), (5), (5), (4), (3), (3), (2), (2), (1), (1)
Host Rabbit
(21), (1)
Application Immunohistochemistry (IHC), Western Blotting (WB)
(22), (13), (8), (5), (1)
Supplier Log in to see

Product Details anti-IVNS1ABP Antibody

Target Details IVNS1ABP Application Details Handling Images
Specificity Influenza Virus Ns1 A Binding Protein antibody was raised against the N terminal of IVNS1 BP
Cross-Reactivity Human, Dog (Canine)
Purification Affinity purified
Immunogen Influenza Virus Ns1 A Binding Protein antibody was raised using the N terminal of IVNS1 BP corresponding to a region with amino acids RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK
Plasmids, Primers & others

Target Details IVNS1ABP

Product Details anti-IVNS1ABP Antibody Application Details Handling Images back to top
Alternative Name Influenza Virus Ns1A Binding Protein (IVNS1ABP Antibody Abstract)
Background This gene encodes a protein which interacts with the nonstructural NS1 protein of the influenza A virus. In noninfected cells, affinity-purified antibodies localized this protein in nuclear regions enriched with the spliceosome assembly factor SC35, suggesting an association with the cellular splicing apparatus. In influenza A virus-infected cells, the protein relocalized throughout the nucleoplasm and appeared distinct from the SC35 domains, which suggests that its function may be disturbed or altered.
Molecular Weight 72 kDa (MW of target protein)
Pathways Negative Regulation of intrinsic apoptotic Signaling

Application Details

Product Details anti-IVNS1ABP Antibody Target Details IVNS1ABP Handling Images back to top
Application Notes WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Influenza Virus Ns1A Binding Protein Blocking Peptide, catalog no. 33R-7827, is also available for use as a blocking control in assays to test for specificity of this Influenza Virus Ns1A Binding Protein antibody

Restrictions For Research Use only


Product Details anti-IVNS1ABP Antibody Target Details IVNS1ABP Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IVNS0 BP antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.