anti-Human TNFRSF1B antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended TNFRSF1B Antibody (supplied by: Log in to see )

Antigen
Tumor Necrosis Factor Receptor Superfamily, Member 1B (TNFRSF1B) Antibodies
  • CD120b
  • TBPII
  • TNF-R-II
  • TNF-R75
  • TNFBR
  • TNFR1B
  • TNFR2
  • TNFR80
  • p75
  • p75TNFR
  • TNF-RII/TNFRSF1B
  • TNFR-II
  • TNFRSF1B
  • TNF-R2
  • TNF-alphaR2
  • TNFRII
  • TNFalpha-R2
  • Tnfr-1
  • Tnfr2
  • rank
  • zgc:163064
  • TNF receptor superfamily member 1B
  • tumor necrosis factor receptor superfamily, member 1b
  • tumor necrosis factor receptor superfamily, member 1B
  • TNFRSF1B
  • Tnfrsf1b
  • tnfrsf1b
Reactivity
Human
196
138
57
6
3
2
2
2
2
2
2
Host
Rabbit
130
95
23
21
17
12
1
Clonality
Polyclonal
Conjugate
This TNFRSF1B antibody is un-conjugated
30
14
9
7
6
6
6
5
4
4
4
3
2
2
2
2
2
2
2
2
2
2
2
2
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
170
114
100
79
56
43
27
23
20
19
13
11
9
9
5
3
3
2
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4360878
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.389673 ABIN784080 IHC (p) IP WB Rabbit IgG C-Term Log in to see Polyclonal 0
12.389673 ABIN1105803 IHC (p) WB Rabbit IgG N-Term Log in to see Polyclonal 0
12.389673 ABIN5947884 FACS ICC IF IHC IHC (p) IP WB Rabbit IgG C-Term Log in to see JM113-01 0
1 ABIN111940 FACS IHC (fro) IHC (p) IP WB Mouse IgG1 Log in to see utr1 7
1 ABIN625943 IHC IHC (p) Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN3044354 IHC (p) WB Rabbit IgG AA 103-121, Middle Region Log in to see Polyclonal 0
1 ABIN1495139 IHC IHC (p) WB Rabbit N-Term Log in to see Polyclonal 0
1 ABIN1104727 ELISA IHC IHC (p) Neut WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1740187 IHC (p) Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN2629431 ICC IF IHC IHC (p) IP WB Rabbit C-Term Log in to see Polyclonal 0
1 ABIN380021 IHC IHC (p) Biotin Mouse Log in to see utr 1 0
1 ABIN4360875 IHC IHC (p) Rabbit C-Term Log in to see Polyclonal 0
1 ABIN602495 ELISA Func IHC IHC (fro) IHC (p) WB Mouse IgG2a Log in to see 0
1 ABIN5957804 ELISA IF IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN5774368 IHC (p) WB Rabbit IgG AA 62-188 Log in to see Polyclonal 0
1 ABIN3029368 IHC (p) WB Rabbit IgG Middle Region Log in to see Polyclonal 0
1 ABIN2153440 IHC (p) WB Rabbit IgG Middle Region Log in to see Polyclonal 0
1 ABIN1690005 IHC (p) WB Rabbit Log in to see Polyclonal 0

General

Antigen Tumor Necrosis Factor Receptor Superfamily, Member 1B (TNFRSF1B) Antibodies
Reactivity Human
(196), (138), (57), (6), (3), (2), (2), (2), (2), (2), (2)
Host Rabbit
(130), (95), (23), (21), (17), (12), (1)
Clonality
Polyclonal
Conjugate This TNFRSF1B antibody is un-conjugated
(30), (14), (9), (7), (6), (6), (6), (5), (4), (4), (4), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(170), (114), (100), (79), (56), (43), (27), (23), (20), (19), (13), (11), (9), (9), (5), (3), (3), (2), (1), (1), (1), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-TNFRSF1B Antibody

Target Details TNFRSF1B Application Details Handling References for anti-TNFRSF1B antibody (ABIN4360878) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:HAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVV
Isotype IgG
Plasmids, Primers & others

Target Details TNFRSF1B

Product Details anti-TNFRSF1B Antibody Application Details Handling References for anti-TNFRSF1B antibody (ABIN4360878) Images back to top
Antigen
Alternative Name TNF RII/TNFRSF1B (TNFRSF1B Antibody Abstract)
Background Gene Symbol: TNFRSF1B
Gene ID 7133
Pathways NF-kappaB Signaling, Apoptosis, Cellular Response to Molecule of Bacterial Origin, Hepatitis C

Application Details

Product Details anti-TNFRSF1B Antibody Target Details TNFRSF1B Handling References for anti-TNFRSF1B antibody (ABIN4360878) Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-TNFRSF1B Antibody Target Details TNFRSF1B Application Details References for anti-TNFRSF1B antibody (ABIN4360878) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-TNFRSF1B antibody (ABIN4360878)

Product Details anti-TNFRSF1B Antibody Target Details TNFRSF1B Application Details Handling Images back to top
Product cited in:

Bachmann, Burté, Pramana, Conte, Brown, Orimadegun, Ajetunmobi, Afolabi, Akinkunmi, Omokhodion, Akinbami, Shokunbi, Kampf, Pawitan, Uhlén, Sodeinde, Schwenk, Wahlgren, Fernandez-Reyes, Nilsson: "Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria." in: PLoS pathogens, Vol. 10, Issue 4, pp. e1004038, 2014

Kato, Nicholson, Neiman, Rantalainen, Holmes, Barrett, Uhlén, Nilsson, Spector, Schwenk: "Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model." in: Proteome science, Vol. 9, pp. 73, 2011

Images

Product Details anti-TNFRSF1B Antibody Target Details TNFRSF1B Application Details Handling References for anti-TNFRSF1B antibody (ABIN4360878) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Tumor Necrosis Factor Receptor Superfamily, Member 1B (TNFRSF1B) antibody (ABIN4360878) Immunohistochemistry-Paraffin: TNF RII/TNFRSF1B Antibody - Staining of human stomach...
Western Blotting (WB) image for anti-Tumor Necrosis Factor Receptor Superfamily, Member 1B (TNFRSF1B) antibody (ABIN4360878) Western Blot: TNF RII/TNFRSF1B Antibody - Analysis in human cell line CAPAN-2.