anti-Human RPS6KB2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended RPS6KB2 Antibody (supplied by: Log in to see )

Antigen
Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 2 (RPS6KB2) Antibodies
  • KLS
  • P70-beta
  • P70-beta-1
  • P70-beta-2
  • S6K-beta2
  • S6K2
  • SRK
  • STK14B
  • p70(S6K)-beta
  • p70S6Kb
  • 70kDa
  • ribosomal protein S6 kinase B2
  • ribosomal protein S6 kinase, polypeptide 2
  • RPS6KB2
  • Rps6kb2
Reactivity
Human, Mouse (Murine), Rat (Rattus)
240
129
81
2
2
2
1
1
Host
Rabbit
208
31
2
Clonality
Polyclonal
Conjugate
This RPS6KB2 antibody is un-conjugated
16
16
15
7
7
7
4
4
4
4
4
4
4
4
4
4
4
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
182
109
54
43
35
27
11
8
5
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4343182
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
10.883729 ABIN702850 IF (p) IHC (p) WB Rabbit IgG pThr444, pSer447 Log in to see Polyclonal 0
10.883729 ABIN2178141 IF (p) IHC (p) WB Rabbit IgG pSer370 Log in to see Polyclonal 0
10.883729 ABIN2744142 ELISA IF IHC IHC (p) WB Mouse IgG2a, kappa AA 1-100 Log in to see 4B11 0
1 ABIN659035 FACS IHC (p) WB Mouse IgG1, kappa Log in to see 164CT21-2-2 0
1 ABIN2855216 ICC IF IHC (p) WB Rabbit IgG Center Log in to see Polyclonal 0
1 ABIN1500792 FACS IHC IHC (p) WB Mouse kappa, IgG1 Log in to see 0
1 ABIN732608 IF (p) IHC (p) WB Rabbit IgG AA 220-250, pThr228 Log in to see Polyclonal 0
1 ABIN652424 FACS IHC (p) WB Rabbit Ig Fraction Log in to see Polyclonal 0
1 ABIN5531787 FACS IHC (p) WB Rabbit Ig Fraction Log in to see Polyclonal 0
1 ABIN6283503 ELISA IHC (p) WB Rabbit IgG AA 360-440 Log in to see Polyclonal 0
1 ABIN5587243 FACS IHC (p) WB Mouse IgG1 kappa Log in to see 164CT21-2-2 0
1 ABIN2627766 IHC IHC (p) IP Rabbit IgG AA 300-350 Log in to see Polyclonal 0
1 ABIN5957340 ELISA IHC (p) WB Rabbit IgG Ser423 Log in to see Polyclonal 0
1 ABIN1414719 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal 0
1 ABIN701674 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal 0
1 ABIN5650188 IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN1396842 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal 0
1 ABIN701667 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal 0
1 ABIN702859 IHC (p) WB HRP Rabbit IgG pThr444, pSer447 Log in to see Polyclonal 0
1 ABIN2178164 IHC (p) WB HRP Rabbit IgG pTyr389 Log in to see Polyclonal 0

General

Antigen Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 2 (RPS6KB2) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(240), (129), (81), (2), (2), (2), (1), (1)
Host Rabbit
(208), (31), (2)
Clonality
Polyclonal
Conjugate This RPS6KB2 antibody is un-conjugated
(16), (16), (15), (7), (7), (7), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(182), (109), (54), (43), (35), (27), (11), (8), (5), (2), (1), (1)
Supplier Log in to see

Product Details anti-RPS6KB2 Antibody

Target Details RPS6KB2 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRAPVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKK
Isotype IgG
Plasmids, Primers & others

Target Details RPS6KB2

Product Details anti-RPS6KB2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name p70 S6 Kinase beta/s6k2 (RPS6KB2 Antibody Abstract)
Background Gene Symbol: RPS6KB2
Gene ID 6199
Pathways PI3K-Akt Signaling, RTK Signaling, AMPK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway

Application Details

Product Details anti-RPS6KB2 Antibody Target Details RPS6KB2 Handling Images back to top
Application Notes Western Blot 1:100-1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20-1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-RPS6KB2 Antibody Target Details RPS6KB2 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-RPS6KB2 Antibody Target Details RPS6KB2 Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 2 (RPS6KB2) antibody (ABIN4343182) Immunohistochemistry-Paraffin: p70 S6 Kinase beta/S6K2 Antibody [NBP1-87805] - Immuno...
Western Blotting (WB) image for anti-Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 2 (RPS6KB2) antibody (ABIN4343182) Western Blot: p70 S6 Kinase beta/S6K2 Antibody [NBP1-87805] - Lane 1: Marker [kDa] 23...
Western Blotting (WB) image for anti-Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 2 (RPS6KB2) antibody (ABIN4343182) Western Blot: p70 S6 Kinase beta/S6K2 Antibody [NBP1-87805] - Lane 1: NIH-3T3 cell ly...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 2 (RPS6KB2) antibody (ABIN4343182) Immunohistochemistry-Paraffin: p70 S6 Kinase beta/S6K2 Antibody - Staining of human ...