anti-Human CoREST antibody for Immunofluorescence

Recommended CoREST Antibody (supplied by: Log in to see )

REST Corepressor 1 (RCOR1) Antibodies
  • RCOR
  • DAUDI6
  • H-2RIIBP
  • NR2B2
  • RCoR-1
  • 5730409O11
  • 6720480E22Rik
  • AU042633
  • D12Wsu95e
  • mKIAA0071
  • rcor1
  • xcoREST
  • RCOR1
  • im:6904264
  • si:dkey-46n18.7
  • zgc:158607
  • RGD1305743
  • REST corepressor 1
  • retinoid X receptor beta
  • REST corepressor 1 L homeolog
  • RCOR1
  • RXRB
  • Rcor1
  • rcor1.L
  • rcor1
This CoREST antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN5079263
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.148272 ABIN4349753 ICC IF IHC IHC (p) Rabbit Log in to see Polyclonal 0
1 ABIN153180 ICC IF IHC IHC (p) PLA WB Rabbit C-Term Log in to see Polyclonal 0
1 ABIN1929929 IF IHC IHC (p) PLA WB Rabbit IgG C-Term Log in to see Polyclonal 0
1 ABIN5586897 IF IHC (p) Rabbit IgG Log in to see Polyclonal 0


Antigen REST Corepressor 1 (RCOR1) Antibodies
Reactivity Human
(61), (11), (5), (4), (3), (3), (3), (2), (2), (1), (1)
Host Rabbit
(44), (20), (1)
Conjugate This CoREST antibody is un-conjugated
(4), (4), (4), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(57), (32), (22), (22), (20), (9), (4), (2), (2), (1)
Supplier Log in to see

Product Details anti-CoREST Antibody

Target Details CoREST Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYASAS
Isotype IgG
Plasmids, Primers & others

Target Details CoREST

Product Details anti-CoREST Antibody Application Details Handling Images back to top
Alternative Name RCOR1/CoREST (RCOR1 Antibody Abstract)
Background Gene Symbol: RCOR1
Gene ID 23186
Pathways Regulation of Hormone Metabolic Process, Chromatin Binding

Application Details

Product Details anti-CoREST Antibody Target Details CoREST Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-CoREST Antibody Target Details CoREST Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-CoREST Antibody Target Details CoREST Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-REST Corepressor 1 (RCOR1) antibody (ABIN5079263) Immunocytochemistry/Immunofluorescence: RCOR1/CoREST Antibody - Staining of human ce...