anti-Human Phospholipase C gamma 2 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended Phospholipase C gamma 2 Antibody (supplied by: Log in to see )

Antigen
Phospholipase C gamma 2 (PLCG2) Antibodies
  • PLCgamma2
  • Plcg-2
  • APLAID
  • FCAS3
  • phospholipase C, gamma 2
  • phospholipase C gamma 2
  • phospholipase C, gamma 2 (phosphatidylinositol-specific)
  • Plcg2
  • PLCG2
Reactivity
Human
285
174
163
12
4
4
4
4
3
1
Host
Rabbit
233
52
Clonality
Polyclonal
Conjugate
This Phospholipase C gamma 2 antibody is un-conjugated
6
6
5
5
5
3
3
3
3
3
3
3
3
3
2
2
2
2
2
2
2
2
2
2
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
206
110
63
60
43
40
36
16
14
10
3
3
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4346133
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
7 ABIN319401 IF IHC (p) Rabbit Tyr1217 Log in to see Polyclonal 4
7 ABIN2888692 ELISA IHC IHC (p) WB Rabbit IgG AA 1186-1235 Log in to see Polyclonal 0
7 ABIN1804116 IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
7 ABIN271905 EIA IHC (p) WB Rabbit Log in to see Polyclonal 0
7 ABIN5585795 ELISA IHC (p) WB Rabbit Log in to see Polyclonal 0
7 ABIN5585794 ELISA IHC (p) WB Rabbit Log in to see Polyclonal 0
7 ABIN5585797 IF IHC (p) Rabbit Log in to see Polyclonal 0
5.5 ABIN700375 IF (p) IHC (p) WB Rabbit IgG AA 660-710 Log in to see Polyclonal 1
5.5 ABIN744848 IF (p) IHC (p) WB Rabbit IgG pTyr759 Log in to see Polyclonal 1
4.8648124 ABIN443064 ICC IF IHC (p) IHC WB Rabbit IgG N-Term Log in to see Polyclonal 0
4 ABIN2878867 ELISA IHC IHC (p) WB Rabbit IgG AA 721-770 Log in to see Polyclonal 0
4 ABIN319283 IHC (p) Rabbit pTyr1217 Log in to see Polyclonal 3
4 ABIN5956494 ELISA IHC (p) WB Rabbit IgG Tyr685, Tyr753 Log in to see Polyclonal 0
4 ABIN5956495 ELISA IHC (p) WB Rabbit IgG pTyr753 Log in to see Polyclonal 0
4 ABIN1738145 IHC (p) ELISA WB Rabbit IgG Internal Region Log in to see Polyclonal 0
4 ABIN272070 IHC (p) WB Rabbit Log in to see Polyclonal 0
4 ABIN4948338 IHC (p) Rabbit pTyr1217 Log in to see Polyclonal 0
1.8648124 ABIN442980 ICC IF IHC (p) IHC WB Rabbit IgG Center Log in to see Polyclonal 0
1.8648124 ABIN4346134 ICC IF IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN700384 IHC (p) WB HRP Rabbit IgG AA 660-710 Log in to see Polyclonal 0

General

Antigen Phospholipase C gamma 2 (PLCG2) Antibodies
Reactivity Human
(285), (174), (163), (12), (4), (4), (4), (4), (3), (1)
Host Rabbit
(233), (52)
Clonality
Polyclonal
Conjugate This Phospholipase C gamma 2 antibody is un-conjugated
(6), (6), (5), (5), (5), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(206), (110), (63), (60), (43), (40), (36), (16), (14), (10), (3), (3), (2), (1)
Supplier Log in to see

Product Details anti-Phospholipase C gamma 2 Antibody

Target Details Phospholipase C gamma 2 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGELYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTMEEEVPQDIPPTELHFGEKWFHKK
Isotype IgG
Plasmids, Primers & others

Target Details Phospholipase C gamma 2

Product Details anti-Phospholipase C gamma 2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name PLC-gamma 2 (PLCG2 Antibody Abstract)
Background Gene Symbol: PLCG2
Gene ID 5336
Pathways RTK Signaling, WNT Signaling, Fc-epsilon Receptor Signaling Pathway, Inositol Metabolic Process, Myometrial Relaxation and Contraction, Toll-Like Receptors Cascades, VEGF Signaling

Application Details

Product Details anti-Phospholipase C gamma 2 Antibody Target Details Phospholipase C gamma 2 Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Phospholipase C gamma 2 Antibody Target Details Phospholipase C gamma 2 Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-Phospholipase C gamma 2 Antibody Target Details Phospholipase C gamma 2 Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Phospholipase C gamma 2 (PLCG2) antibody (ABIN4346133) Immunohistochemistry-Paraffin: PLCG 2 Antibody [NBP1-86030] - Staining of human lymph...
Western Blotting (WB) image for anti-Phospholipase C gamma 2 (PLCG2) antibody (ABIN4346133) Western Blot: PLCG 2 Antibody [NBP1-86030] - Lane 1: Marker [kDa] 230, 130, 95, 72, 5...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Phospholipase C gamma 2 (PLCG2) antibody (ABIN4346133) Immunohistochemistry-Paraffin: PLC-gamma 2 Antibody - Staining of human tonsil shows...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Phospholipase C gamma 2 (PLCG2) antibody (ABIN4346133) Immunohistochemistry-Paraffin: PLC-gamma 2 Antibody - Staining of human pancreas sho...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Phospholipase C gamma 2 (PLCG2) antibody (ABIN4346133) Immunohistochemistry-Paraffin: PLC-gamma 2 Antibody - Staining in human tonsil and p...