AIF antibody (AA 151-180)

Catalog No. ABIN1099879

Product Details anti-AIF Antibody

Target: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Binding Specificity: AA 151-180

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AIF antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Brand: IHC-plus™

Purification: Affinity purified

Immunogen: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) conjugated to BSA

Isotype: IgG

Application Details

Application Notes: Approved: IHC, IHC-P (5 μg/mL), WB

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: TBS containing 50 % glycerol, 0.5 mg/mL BSA, and 0.02 % sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles.

Storage: 4 °C,-20 °C

Storage Comment: Short term 4°C, long term aliquot and store at -20°C, avoid freeze-thaw cycles.

Target Details for AIF

Target: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Alternative Name: AIFM1 / AIF / PDCD8 (AIFM1 Products)

Synonyms: AIF antibody, CMTX4 antibody, COWCK antibody, COXPD6 antibody, PDCD8 antibody, CG7263 antibody, DmAIF antibody, Dmel\\CG7263 antibody, GB16024 antibody, DDBDRAFT_0187853 antibody, DDBDRAFT_0191137 antibody, DDB_0187853 antibody, DDB_0191137 antibody, aif antibody, pdcd8 antibody, AIFM1 antibody, PCD8 antibody, AIFsh2 antibody, Hq antibody, Pdcd8 antibody, mAIF antibody, Aif antibody, zgc:91994 antibody, apoptosis inducing factor mitochondria associated 1 antibody, allograft inflammatory factor 1 antibody, Apoptosis inducing factor antibody, apoptosis-inducing factor 1, mitochondrial antibody, apoptosis inducing factor antibody, apoptosis inducing factor, mitochondria associated 1 antibody, apoptosis-inducing factor, mitochondrion-associated, 1 antibody, apoptosis-inducing factor, mitochondrion-associated 1 antibody, AIFM1 antibody, AIF1 antibody, AIF antibody, LOC412212 antibody, aif antibody, aifm1 antibody, Aifm1 antibody

Background: Name/Gene ID: AIFM1
Family: Apoptosis

Synonyms: AIFM1, AIF, COXPD6, PDCD8, Programmed cell death 8

Gene ID: 9131

UniProt: O95831

Pathways: Apoptosis, Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis, Smooth Muscle Cell Migration, Warburg Effect